Detailed information of TA system TA248568

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 31123..31549
• Replicon: plasmid unnamed2
• Accession: NZ_CP099346
• Organism: Escherichia marmotae strain RHB35-E2-C08

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NFK54_RS24415
• Protein ID: WP_001372321.1
• Coordinates: 31424..31549 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	31123..31347 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NFK54_RS24375 (26299)	26299..26733	-	435	Protein_32	hypothetical protein	-
NFK54_RS24380 (26803)	26803..27009	+	207	WP_024195845.1	hypothetical protein	-
NFK54_RS24385 (27035)	27035..27574	+	540	WP_045896589.1	single-stranded DNA-binding protein	-
NFK54_RS24390 (27631)	27631..27864	+	234	WP_001470808.1	DUF905 domain-containing protein	-
NFK54_RS24395 (27928)	27928..29892	+	1965	WP_279283706.1	ParB/RepB/Spo0J family partition protein	-
NFK54_RS24400 (29961)	29961..30395	+	435	WP_089587306.1	conjugation system SOS inhibitor PsiB	-
NFK54_RS24405 (30392)	30392..31154	+	763	Protein_38	plasmid SOS inhibition protein A	-
- (31280)	31280..31345	+	66	NuclAT_1	-	-
- (31123)	31123..31347	+	225	NuclAT_0	-	Antitoxin
- (31123)	31123..31347	+	225	NuclAT_0	-	Antitoxin
- (31123)	31123..31347	+	225	NuclAT_0	-	Antitoxin
- (31123)	31123..31347	+	225	NuclAT_0	-	Antitoxin
- (31123)	31123..31347	-	225	NuclAT_0	-	-
NFK54_RS24410 (31333)	31333..31482	+	150	Protein_39	plasmid maintenance protein Mok	-
NFK54_RS24415 (31424)	31424..31549	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NFK54_RS24420 (31850)	31850..32146	-	297	Protein_41	hypothetical protein	-
NFK54_RS24425 (32216)	32216..32422	+	207	WP_127766627.1	single-stranded DNA-binding protein	-
NFK54_RS24430 (32446)	32446..32742	+	297	WP_032083169.1	hypothetical protein	-
NFK54_RS24435 (32901)	32901..33143	+	243	WP_000540591.1	hypothetical protein	-
NFK54_RS24440 (33140)	33140..33259	+	120	Protein_45	class I SAM-dependent methyltransferase	-
NFK54_RS24445 (33348)	33348..33764	-	417	Protein_46	hypothetical protein	-
NFK54_RS24450 (33834)	33834..34040	+	207	WP_279283664.1	single-stranded DNA-binding protein	-
NFK54_RS24455 (34063)	34063..34359	+	297	WP_001272240.1	hypothetical protein	-
NFK54_RS24460 (34466)	34466..35287	+	822	WP_001234451.1	DUF932 domain-containing protein	-
NFK54_RS24465 (35566)	35566..36018	-	453	WP_024212709.1	transglycosylase SLT domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	-	1..72595	72595

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T248568 WP_001372321.1 NZ_CP099346:31424-31549 [Escherichia marmotae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT248568 NZ_CP099346:31123-31347 [Escherichia marmotae]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin