Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 3797845..3798103 Replicon chromosome
Accession NZ_CP099344
Organism Escherichia marmotae strain RHB35-E2-C08

Toxin (Protein)


Gene name hokC Uniprot ID S1NX00
Locus tag NFK54_RS18515 Protein ID WP_000809168.1
Coordinates 3797845..3797997 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 3798046..3798103 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK54_RS18490 3793170..3793736 - 567 WP_000528538.1 acetate uptake transporter -
NFK54_RS18495 3793885..3793998 - 114 Protein_3609 hypothetical protein -
NFK54_RS18500 3794028..3794228 - 201 Protein_3610 DUF2541 family protein -
NFK54_RS18505 3794605..3796521 + 1917 WP_000516135.1 molecular chaperone DnaK -
NFK54_RS18510 3796610..3797740 + 1131 WP_001118463.1 molecular chaperone DnaJ -
NFK54_RS18515 3797845..3797997 - 153 WP_000809168.1 type I toxin-antitoxin system toxin MokC Toxin
- 3798046..3798103 + 58 - - Antitoxin
NFK54_RS18520 3798581..3799747 + 1167 WP_105275909.1 Na+/H+ antiporter NhaA -
NFK54_RS18525 3799807..3800712 + 906 WP_000062876.1 transcriptional activator NhaR -
NFK54_RS18530 3800815..3801078 - 264 WP_001274018.1 30S ribosomal protein S20 -
NFK54_RS18535 3801181..3801399 + 219 Protein_3617 DUF2575 domain-containing protein -
NFK54_RS18540 3801407..3802348 + 942 WP_000767344.1 bifunctional riboflavin kinase/FAD synthetase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5501.57 Da        Isoelectric Point: 7.1312

>T248561 WP_000809168.1 NZ_CP099344:c3797997-3797845 [Escherichia marmotae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT248561 NZ_CP099344:3798046-3798103 [Escherichia marmotae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1NX00

Antitoxin

Download structure file

References