Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3797845..3798103 | Replicon | chromosome |
| Accession | NZ_CP099344 | ||
| Organism | Escherichia marmotae strain RHB35-E2-C08 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NFK54_RS18515 | Protein ID | WP_000809168.1 |
| Coordinates | 3797845..3797997 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3798046..3798103 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK54_RS18490 | 3793170..3793736 | - | 567 | WP_000528538.1 | acetate uptake transporter | - |
| NFK54_RS18495 | 3793885..3793998 | - | 114 | Protein_3609 | hypothetical protein | - |
| NFK54_RS18500 | 3794028..3794228 | - | 201 | Protein_3610 | DUF2541 family protein | - |
| NFK54_RS18505 | 3794605..3796521 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| NFK54_RS18510 | 3796610..3797740 | + | 1131 | WP_001118463.1 | molecular chaperone DnaJ | - |
| NFK54_RS18515 | 3797845..3797997 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 3798046..3798103 | + | 58 | - | - | Antitoxin |
| NFK54_RS18520 | 3798581..3799747 | + | 1167 | WP_105275909.1 | Na+/H+ antiporter NhaA | - |
| NFK54_RS18525 | 3799807..3800712 | + | 906 | WP_000062876.1 | transcriptional activator NhaR | - |
| NFK54_RS18530 | 3800815..3801078 | - | 264 | WP_001274018.1 | 30S ribosomal protein S20 | - |
| NFK54_RS18535 | 3801181..3801399 | + | 219 | Protein_3617 | DUF2575 domain-containing protein | - |
| NFK54_RS18540 | 3801407..3802348 | + | 942 | WP_000767344.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T248561 WP_000809168.1 NZ_CP099344:c3797997-3797845 [Escherichia marmotae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT248561 NZ_CP099344:3798046-3798103 [Escherichia marmotae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|