Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokC/Ldr(toxin) |
| Location | 879588..879811 | Replicon | chromosome |
| Accession | NZ_CP099344 | ||
| Organism | Escherichia marmotae strain RHB35-E2-C08 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | - |
| Locus tag | NFK54_RS04545 | Protein ID | WP_222656830.1 |
| Coordinates | 879704..879811 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 879588..879654 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK54_RS04520 | 874868..876262 | - | 1395 | WP_181502796.1 | YchO/YchP family invasin | - |
| NFK54_RS04525 | 876446..876799 | + | 354 | WP_001169672.1 | DsrE/F sulfur relay family protein YchN | - |
| NFK54_RS04530 | 876843..877538 | - | 696 | WP_016248767.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| NFK54_RS04535 | 877696..877926 | - | 231 | WP_001146437.1 | putative cation transport regulator ChaB | - |
| NFK54_RS04540 | 878195..879295 | + | 1101 | WP_279283463.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 879588..879654 | - | 67 | - | - | Antitoxin |
| NFK54_RS04545 | 879704..879811 | + | 108 | WP_222656830.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| NFK54_RS04550 | 879991..880845 | - | 855 | WP_000811071.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| NFK54_RS04555 | 880881..881690 | - | 810 | WP_001257034.1 | invasion regulator SirB1 | - |
| NFK54_RS04560 | 881694..882086 | - | 393 | WP_222692457.1 | invasion regulator SirB2 | - |
| NFK54_RS04565 | 882083..882916 | - | 834 | WP_000456440.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| NFK54_RS04570 | 882916..883998 | - | 1083 | WP_279283464.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T248556 WP_222656830.1 NZ_CP099344:879704-879811 [Escherichia marmotae]
MTLTQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT248556 NZ_CP099344:c879654-879588 [Escherichia marmotae]
TGTTTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT
TGTTTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|