Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 63334..63598 Replicon plasmid unnamed1
Accession NZ_CP099339
Organism Escherichia fergusonii strain RHB44-C01

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag NFK94_RS22140 Protein ID WP_001331364.1
Coordinates 63446..63598 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 63334..63391 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK94_RS22125 (58573) 58573..60864 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
NFK94_RS22130 (60857) 60857..61927 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
NFK94_RS22135 (61946) 61946..63154 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (63334) 63334..63391 - 58 NuclAT_0 - Antitoxin
- (63334) 63334..63391 - 58 NuclAT_0 - Antitoxin
- (63334) 63334..63391 - 58 NuclAT_0 - Antitoxin
- (63334) 63334..63391 - 58 NuclAT_0 - Antitoxin
NFK94_RS22140 (63446) 63446..63598 + 153 WP_001331364.1 Hok/Gef family protein Toxin
NFK94_RS22145 (63670) 63670..63921 - 252 WP_001291964.1 hypothetical protein -
NFK94_RS22150 (64420) 64420..64515 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
NFK94_RS22155 (64580) 64580..64756 - 177 WP_001054904.1 hypothetical protein -
NFK94_RS22160 (65148) 65148..65357 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NFK94_RS22165 (65429) 65429..66079 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
NFK94_RS22170 (66153) 66153..68321 - 2169 WP_021537350.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA1 / ant(3'')-Ia / blaTEM-1B / sul2 - 1..108225 108225


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T248541 WP_001331364.1 NZ_CP099339:63446-63598 [Escherichia fergusonii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT248541 NZ_CP099339:c63391-63334 [Escherichia fergusonii]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References