Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4259235..4259492 | Replicon | chromosome |
| Accession | NZ_CP099338 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | F4T5C6 |
| Locus tag | NFK94_RS20645 | Protein ID | WP_001135731.1 |
| Coordinates | 4259235..4259387 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 4259444..4259492 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS20615 | 4255101..4255811 | - | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
| NFK94_RS20620 | 4256249..4257619 | + | 1371 | WP_104920428.1 | MFS transporter | - |
| NFK94_RS20625 | 4257869..4258159 | + | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
| NFK94_RS20630 | 4258440..4258652 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| NFK94_RS20635 | 4258706..4259077 | - | 372 | WP_104920427.1 | membrane protein insertion efficiency factor YidD | - |
| NFK94_RS20640 | 4259187..4259258 | + | 72 | WP_216665726.1 | hypothetical protein | - |
| NFK94_RS20645 | 4259235..4259387 | - | 153 | WP_001135731.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 4259444..4259492 | + | 49 | - | - | Antitoxin |
| NFK94_RS20650 | 4259709..4261778 | - | 2070 | WP_264783749.1 | glycine--tRNA ligase subunit beta | - |
| NFK94_RS20655 | 4261788..4262699 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| NFK94_RS20660 | 4262795..4263094 | - | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
| NFK94_RS20665 | 4263266..4264261 | + | 996 | WP_002432855.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 6025.30 Da Isoelectric Point: 7.7169
>T248539 WP_001135731.1 NZ_CP099338:c4259387-4259235 [Escherichia fergusonii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT248539 NZ_CP099338:4259444-4259492 [Escherichia fergusonii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|