Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 4230056..4230275 | Replicon | chromosome |
| Accession | NZ_CP099338 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | NFK94_RS20505 | Protein ID | WP_000170738.1 |
| Coordinates | 4230056..4230163 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4230212..4230275 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS20475 (4225106) | 4225106..4225294 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
| NFK94_RS20480 (4225581) | 4225581..4227140 | + | 1560 | WP_001070267.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| NFK94_RS20485 (4227137) | 4227137..4227328 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| NFK94_RS20490 (4227325) | 4227325..4229004 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| NFK94_RS20495 (4229091) | 4229091..4229198 | - | 108 | WP_000170746.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| NFK94_RS20500 (4229574) | 4229574..4229681 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_16 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_16 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_16 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_16 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_18 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_18 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_18 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_18 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_20 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_20 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_20 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_20 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_22 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_22 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_22 | - | - |
| - (4229730) | 4229730..4229793 | + | 64 | NuclAT_22 | - | - |
| - (4229730) | 4229730..4229795 | + | 66 | NuclAT_11 | - | - |
| - (4229730) | 4229730..4229795 | + | 66 | NuclAT_11 | - | - |
| - (4229730) | 4229730..4229795 | + | 66 | NuclAT_11 | - | - |
| - (4229730) | 4229730..4229795 | + | 66 | NuclAT_11 | - | - |
| - (4229730) | 4229730..4229795 | + | 66 | NuclAT_13 | - | - |
| - (4229730) | 4229730..4229795 | + | 66 | NuclAT_13 | - | - |
| - (4229730) | 4229730..4229795 | + | 66 | NuclAT_13 | - | - |
| - (4229730) | 4229730..4229795 | + | 66 | NuclAT_13 | - | - |
| NFK94_RS20505 (4230056) | 4230056..4230163 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_15 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_15 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_15 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_15 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_17 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_17 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_17 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_17 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_19 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_19 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_19 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_19 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_21 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_21 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_21 | - | Antitoxin |
| - (4230212) | 4230212..4230275 | + | 64 | NuclAT_21 | - | Antitoxin |
| - (4230212) | 4230212..4230277 | + | 66 | NuclAT_10 | - | - |
| - (4230212) | 4230212..4230277 | + | 66 | NuclAT_10 | - | - |
| - (4230212) | 4230212..4230277 | + | 66 | NuclAT_10 | - | - |
| - (4230212) | 4230212..4230277 | + | 66 | NuclAT_10 | - | - |
| - (4230212) | 4230212..4230277 | + | 66 | NuclAT_12 | - | - |
| - (4230212) | 4230212..4230277 | + | 66 | NuclAT_12 | - | - |
| - (4230212) | 4230212..4230277 | + | 66 | NuclAT_12 | - | - |
| - (4230212) | 4230212..4230277 | + | 66 | NuclAT_12 | - | - |
| NFK94_RS20510 (4230599) | 4230599..4231795 | + | 1197 | WP_104920204.1 | methionine gamma-lyase | - |
| NFK94_RS20515 (4232045) | 4232045..4233343 | + | 1299 | WP_160193754.1 | amino acid permease | - |
| NFK94_RS20520 (4233359) | 4233359..4234570 | - | 1212 | WP_181198553.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T248537 WP_000170738.1 NZ_CP099338:c4230163-4230056 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 64 bp
>AT248537 NZ_CP099338:4230212-4230275 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
