Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2170889..2171451 | Replicon | chromosome |
| Accession | NZ_CP099338 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NFK94_RS10360 | Protein ID | WP_104919749.1 |
| Coordinates | 2171173..2171451 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1PAQ1 |
| Locus tag | NFK94_RS10355 | Protein ID | WP_000781370.1 |
| Coordinates | 2170889..2171173 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS10340 (2166248) | 2166248..2169295 | + | 3048 | WP_141095958.1 | formate dehydrogenase-N subunit alpha | - |
| NFK94_RS10345 (2169308) | 2169308..2170192 | + | 885 | WP_001240580.1 | formate dehydrogenase N subunit beta | - |
| NFK94_RS10350 (2170185) | 2170185..2170838 | + | 654 | WP_000045648.1 | formate dehydrogenase-N subunit gamma | - |
| NFK94_RS10355 (2170889) | 2170889..2171173 | - | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
| NFK94_RS10360 (2171173) | 2171173..2171451 | - | 279 | WP_104919749.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK94_RS10365 (2171637) | 2171637..2172647 | - | 1011 | WP_000642407.1 | alcohol dehydrogenase AdhP | - |
| NFK94_RS10370 (2172782) | 2172782..2174479 | - | 1698 | WP_046077566.1 | malate dehydrogenase | - |
| NFK94_RS10375 (2174636) | 2174636..2174773 | - | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
| NFK94_RS10380 (2174875) | 2174875..2175090 | - | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
| NFK94_RS10385 (2175433) | 2175433..2175864 | + | 432 | WP_000152299.1 | peroxiredoxin OsmC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10521.10 Da Isoelectric Point: 7.3562
>T248531 WP_104919749.1 NZ_CP099338:c2171451-2171173 [Escherichia fergusonii]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADLDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADLDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2ICT | |
| PDB | 2ICP | |
| AlphaFold DB | A0A829CUG6 |