Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1222057..1222736 | Replicon | chromosome |
| Accession | NZ_CP099338 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B7LJF3 |
| Locus tag | NFK94_RS05990 | Protein ID | WP_002431667.1 |
| Coordinates | 1222057..1222359 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFK94_RS05995 | Protein ID | WP_000806440.1 |
| Coordinates | 1222395..1222736 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS05965 (1217433) | 1217433..1219085 | + | 1653 | WP_160193899.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| NFK94_RS05970 (1219123) | 1219123..1219626 | - | 504 | WP_000667001.1 | hypothetical protein | - |
| NFK94_RS05975 (1219623) | 1219623..1220423 | - | 801 | WP_160193901.1 | hypothetical protein | - |
| NFK94_RS05980 (1220447) | 1220447..1220926 | - | 480 | WP_000186628.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| NFK94_RS05985 (1221130) | 1221130..1221924 | - | 795 | WP_046081753.1 | TraB/GumN family protein | - |
| NFK94_RS05990 (1222057) | 1222057..1222359 | + | 303 | WP_002431667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK94_RS05995 (1222395) | 1222395..1222736 | + | 342 | WP_000806440.1 | HigA family addiction module antitoxin | Antitoxin |
| NFK94_RS06000 (1222850) | 1222850..1225354 | - | 2505 | WP_000083946.1 | copper-exporting P-type ATPase CopA | - |
| NFK94_RS06005 (1225661) | 1225661..1226950 | + | 1290 | WP_000102764.1 | APC family permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11811.37 Da Isoelectric Point: 10.1572
>T248526 WP_002431667.1 NZ_CP099338:1222057-1222359 [Escherichia fergusonii]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELYLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELYLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|