Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1004065..1004311 | Replicon | chromosome |
Accession | NZ_CP099338 | ||
Organism | Escherichia fergusonii strain RHB44-C01 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | NFK94_RS04885 | Protein ID | WP_000956458.1 |
Coordinates | 1004159..1004311 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1004065..1004117 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK94_RS04870 | 999573..1001372 | + | 1800 | WP_104920142.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
NFK94_RS04875 | 1001372..1003084 | + | 1713 | WP_104920141.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
NFK94_RS04880 | 1003158..1003892 | + | 735 | WP_046083134.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1004065..1004117 | - | 53 | - | - | Antitoxin |
NFK94_RS04885 | 1004159..1004311 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
NFK94_RS04890 | 1004504..1007204 | + | 2701 | Protein_946 | CRISPR-associated helicase Cas3' | - |
NFK94_RS04895 | 1007670..1009232 | + | 1563 | WP_104920139.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T248525 WP_000956458.1 NZ_CP099338:1004159-1004311 [Escherichia fergusonii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT248525 NZ_CP099338:c1004117-1004065 [Escherichia fergusonii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|