Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 702690..702948 | Replicon | chromosome |
| Accession | NZ_CP099338 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | - |
| Locus tag | NFK94_RS03510 | Protein ID | WP_000809173.1 |
| Coordinates | 702690..702842 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 702891..702948 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS03490 | 697754..698341 | + | 588 | WP_046083027.1 | molybdopterin adenylyltransferase | - |
| NFK94_RS03495 | 698375..698941 | - | 567 | WP_000528529.1 | acetate uptake transporter | - |
| NFK94_RS03500 | 699449..701365 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| NFK94_RS03505 | 701454..702584 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| NFK94_RS03510 | 702690..702842 | - | 153 | WP_000809173.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 702891..702948 | + | 58 | - | - | Antitoxin |
| NFK94_RS03515 | 703383..704549 | + | 1167 | WP_000681374.1 | Na+/H+ antiporter NhaA | - |
| NFK94_RS03520 | 704617..705516 | + | 900 | WP_000019050.1 | transcriptional activator NhaR | - |
| NFK94_RS03525 | 705612..705875 | - | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
| NFK94_RS03530 | 705978..706196 | + | 219 | WP_012599853.1 | DUF2575 family protein | - |
| NFK94_RS03535 | 706204..707145 | + | 942 | WP_000767324.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5487.54 Da Isoelectric Point: 7.1312
>T248522 WP_000809173.1 NZ_CP099338:c702842-702690 [Escherichia fergusonii]
MKQHKAMIVALIVICVTAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICVTAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT248522 NZ_CP099338:702891-702948 [Escherichia fergusonii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|