Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 605760..606559 | Replicon | chromosome |
| Accession | NZ_CP099338 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | NFK94_RS02970 | Protein ID | WP_000347270.1 |
| Coordinates | 605760..606224 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | NFK94_RS02975 | Protein ID | WP_104919918.1 |
| Coordinates | 606224..606559 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS02940 (600761) | 600761..601195 | - | 435 | WP_032303830.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NFK94_RS02945 (601213) | 601213..602091 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NFK94_RS02950 (602081) | 602081..602860 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NFK94_RS02955 (602871) | 602871..603344 | - | 474 | WP_032303829.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NFK94_RS02960 (603367) | 603367..604647 | - | 1281 | WP_104917761.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NFK94_RS02965 (604896) | 604896..605705 | + | 810 | WP_279279767.1 | aga operon transcriptional regulator AgaR | - |
| NFK94_RS02970 (605760) | 605760..606224 | - | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NFK94_RS02975 (606224) | 606224..606559 | - | 336 | WP_104919918.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NFK94_RS02980 (606708) | 606708..608279 | - | 1572 | WP_104919919.1 | galactarate dehydratase | - |
| NFK94_RS02985 (608750) | 608750..609520 | + | 771 | WP_001058567.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NFK94_RS02990 (609545) | 609545..610435 | + | 891 | WP_000178100.1 | 2-hydroxy-3-oxopropionate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T248521 WP_000347270.1 NZ_CP099338:c606224-605760 [Escherichia fergusonii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|