Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 76141..76405 Replicon plasmid unnamed1
Accession NZ_CP099332
Organism Escherichia fergusonii strain RHB44-C03

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag NFK96_RS21970 Protein ID WP_001303307.1
Coordinates 76253..76405 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 76141..76203 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK96_RS21955 (71380) 71380..73671 - 2292 WP_001289275.1 F-type conjugative transfer protein TrbC -
NFK96_RS21960 (73664) 73664..74734 - 1071 WP_000151576.1 IncI1-type conjugal transfer protein TrbB -
NFK96_RS21965 (74753) 74753..75961 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (76141) 76141..76203 - 63 NuclAT_0 - Antitoxin
- (76141) 76141..76203 - 63 NuclAT_0 - Antitoxin
- (76141) 76141..76203 - 63 NuclAT_0 - Antitoxin
- (76141) 76141..76203 - 63 NuclAT_0 - Antitoxin
NFK96_RS21970 (76253) 76253..76405 + 153 WP_001303307.1 Hok/Gef family protein Toxin
NFK96_RS21975 (76477) 76477..76728 - 252 WP_001291965.1 hypothetical protein -
NFK96_RS21980 (77228) 77228..77323 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
NFK96_RS21985 (77388) 77388..77525 - 138 WP_047088497.1 hypothetical protein -
NFK96_RS21990 (77570) 77570..78796 - 1227 WP_024186316.1 RNA-guided endonuclease TnpB family protein -
NFK96_RS21995 (78855) 78855..79259 + 405 WP_001175009.1 IS200/IS605 family transposase -
NFK96_RS22000 (79591) 79591..79800 - 210 WP_032178830.1 hemolysin expression modulator Hha -
NFK96_RS22005 (79898) 79898..80560 - 663 WP_000644794.1 plasmid IncI1-type surface exclusion protein ExcA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - iutA / iucD / iucC / iucB / iucA / fdeC 1..121001 121001


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T248512 WP_001303307.1 NZ_CP099332:76253-76405 [Escherichia fergusonii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT248512 NZ_CP099332:c76203-76141 [Escherichia fergusonii]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References