Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 4224757..4225014 Replicon chromosome
Accession NZ_CP099331
Organism Escherichia fergusonii strain RHB44-C03

Toxin (Protein)


Gene name hokA Uniprot ID F4T5C6
Locus tag NFK96_RS20330 Protein ID WP_001135731.1
Coordinates 4224757..4224909 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 4224966..4225014 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK96_RS20300 4220622..4221332 - 711 WP_000190514.1 DUF3053 domain-containing protein -
NFK96_RS20305 4221770..4223140 + 1371 WP_000184983.1 MFS transporter -
NFK96_RS20310 4223390..4223680 + 291 WP_279284639.1 HTH-type transcriptional regulator -
NFK96_RS20315 4223962..4224174 + 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
NFK96_RS20320 4224228..4224599 - 372 WP_223684294.1 membrane protein insertion efficiency factor YidD -
NFK96_RS20325 4224709..4224780 + 72 WP_216665726.1 hypothetical protein -
NFK96_RS20330 4224757..4224909 - 153 WP_001135731.1 type I toxin-antitoxin system toxin HokA Toxin
- 4224966..4225014 + 49 - - Antitoxin
NFK96_RS20335 4225231..4227300 - 2070 WP_001291786.1 glycine--tRNA ligase subunit beta -
NFK96_RS20340 4227310..4228221 - 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
NFK96_RS20345 4228317..4228616 - 300 WP_223684293.1 YsaB family lipoprotein -
NFK96_RS20350 4228788..4229783 + 996 WP_223684292.1 acyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 6025.30 Da        Isoelectric Point: 7.7169

>T248511 WP_001135731.1 NZ_CP099331:c4224909-4224757 [Escherichia fergusonii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 49 bp

>AT248511 NZ_CP099331:4224966-4225014 [Escherichia fergusonii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061YDD9

Antitoxin

Download structure file

References