Detailed information of TA system TA248507

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-OrzO/Ldr(toxin)
• Location: 4195410..4195631
• Replicon: chromosome
• Accession: NZ_CP099331
• Organism: Escherichia fergusonii strain RHB44-C03

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: NFK96_RS20185
• Protein ID: WP_001295224.1
• Coordinates: 4195410..4195517 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	OrzO
Locus tag	-
Coordinates	4195565..4195631 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NFK96_RS20155	4190452..4192011	+	1560	WP_001070267.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-
NFK96_RS20160	4192008..4192199	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
NFK96_RS20165	4192196..4193875	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
NFK96_RS20170	4193962..4194069	-	108	WP_149012441.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4194127..4194181	+	55	NuclAT_16	-	-
-	4194127..4194181	+	55	NuclAT_16	-	-
-	4194127..4194181	+	55	NuclAT_16	-	-
-	4194127..4194181	+	55	NuclAT_16	-	-
-	4194127..4194181	+	55	NuclAT_19	-	-
-	4194127..4194181	+	55	NuclAT_19	-	-
-	4194127..4194181	+	55	NuclAT_19	-	-
-	4194127..4194181	+	55	NuclAT_19	-	-
-	4194127..4194181	+	55	NuclAT_22	-	-
-	4194127..4194181	+	55	NuclAT_22	-	-
-	4194127..4194181	+	55	NuclAT_22	-	-
-	4194127..4194181	+	55	NuclAT_22	-	-
-	4194127..4194181	+	55	NuclAT_25	-	-
-	4194127..4194181	+	55	NuclAT_25	-	-
-	4194127..4194181	+	55	NuclAT_25	-	-
-	4194127..4194181	+	55	NuclAT_25	-	-
-	4194127..4194183	+	57	NuclAT_12	-	-
-	4194127..4194183	+	57	NuclAT_12	-	-
-	4194127..4194183	+	57	NuclAT_12	-	-
-	4194127..4194183	+	57	NuclAT_12	-	-
-	4194127..4194183	+	57	NuclAT_9	-	-
-	4194127..4194183	+	57	NuclAT_9	-	-
-	4194127..4194183	+	57	NuclAT_9	-	-
-	4194127..4194183	+	57	NuclAT_9	-	-
NFK96_RS20175	4194445..4194552	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
NFK96_RS20180	4194927..4195034	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4195083..4195146	+	64	NuclAT_15	-	-
-	4195083..4195146	+	64	NuclAT_15	-	-
-	4195083..4195146	+	64	NuclAT_15	-	-
-	4195083..4195146	+	64	NuclAT_15	-	-
-	4195083..4195146	+	64	NuclAT_18	-	-
-	4195083..4195146	+	64	NuclAT_18	-	-
-	4195083..4195146	+	64	NuclAT_18	-	-
-	4195083..4195146	+	64	NuclAT_18	-	-
-	4195083..4195146	+	64	NuclAT_21	-	-
-	4195083..4195146	+	64	NuclAT_21	-	-
-	4195083..4195146	+	64	NuclAT_21	-	-
-	4195083..4195146	+	64	NuclAT_21	-	-
-	4195083..4195146	+	64	NuclAT_24	-	-
-	4195083..4195146	+	64	NuclAT_24	-	-
-	4195083..4195146	+	64	NuclAT_24	-	-
-	4195083..4195146	+	64	NuclAT_24	-	-
-	4195083..4195148	+	66	NuclAT_11	-	-
-	4195083..4195148	+	66	NuclAT_11	-	-
-	4195083..4195148	+	66	NuclAT_11	-	-
-	4195083..4195148	+	66	NuclAT_11	-	-
-	4195083..4195148	+	66	NuclAT_8	-	-
-	4195083..4195148	+	66	NuclAT_8	-	-
-	4195083..4195148	+	66	NuclAT_8	-	-
-	4195083..4195148	+	66	NuclAT_8	-	-
NFK96_RS20185	4195410..4195517	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4195565..4195631	+	67	-	-	Antitoxin
NFK96_RS20190	4195954..4197150	+	1197	WP_180492127.1	methionine gamma-lyase	-
NFK96_RS20195	4197399..4198697	+	1299	WP_148047743.1	amino acid permease	-
NFK96_RS20200	4198713..4199924	-	1212	WP_181667968.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T248507 WP_001295224.1 NZ_CP099331:c4195517-4195410 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT248507 NZ_CP099331:4195565-4195631 [Escherichia fergusonii]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin