Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokA/Ldr(toxin) |
| Location | 4194927..4195148 | Replicon | chromosome |
| Accession | NZ_CP099331 | ||
| Organism | Escherichia fergusonii strain RHB44-C03 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | NFK96_RS20180 | Protein ID | WP_000170738.1 |
| Coordinates | 4194927..4195034 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 4195082..4195148 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK96_RS20150 | 4189977..4190165 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
| NFK96_RS20155 | 4190452..4192011 | + | 1560 | WP_001070267.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| NFK96_RS20160 | 4192008..4192199 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| NFK96_RS20165 | 4192196..4193875 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| NFK96_RS20170 | 4193962..4194069 | - | 108 | WP_149012441.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4194127..4194181 | + | 55 | NuclAT_16 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_16 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_16 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_16 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_19 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_19 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_19 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_19 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_22 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_22 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_22 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_22 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_25 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_25 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_25 | - | - |
| - | 4194127..4194181 | + | 55 | NuclAT_25 | - | - |
| - | 4194127..4194183 | + | 57 | NuclAT_12 | - | - |
| - | 4194127..4194183 | + | 57 | NuclAT_12 | - | - |
| - | 4194127..4194183 | + | 57 | NuclAT_12 | - | - |
| - | 4194127..4194183 | + | 57 | NuclAT_12 | - | - |
| - | 4194127..4194183 | + | 57 | NuclAT_9 | - | - |
| - | 4194127..4194183 | + | 57 | NuclAT_9 | - | - |
| - | 4194127..4194183 | + | 57 | NuclAT_9 | - | - |
| - | 4194127..4194183 | + | 57 | NuclAT_9 | - | - |
| NFK96_RS20175 | 4194445..4194552 | - | 108 | WP_002431793.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| NFK96_RS20180 | 4194927..4195034 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4195082..4195148 | + | 67 | - | - | Antitoxin |
| NFK96_RS20185 | 4195410..4195517 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4195566..4195629 | + | 64 | NuclAT_14 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_14 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_14 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_14 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_17 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_17 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_17 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_17 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_20 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_20 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_20 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_20 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_23 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_23 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_23 | - | - |
| - | 4195566..4195629 | + | 64 | NuclAT_23 | - | - |
| - | 4195566..4195631 | + | 66 | NuclAT_10 | - | - |
| - | 4195566..4195631 | + | 66 | NuclAT_10 | - | - |
| - | 4195566..4195631 | + | 66 | NuclAT_10 | - | - |
| - | 4195566..4195631 | + | 66 | NuclAT_10 | - | - |
| - | 4195566..4195631 | + | 66 | NuclAT_7 | - | - |
| - | 4195566..4195631 | + | 66 | NuclAT_7 | - | - |
| - | 4195566..4195631 | + | 66 | NuclAT_7 | - | - |
| - | 4195566..4195631 | + | 66 | NuclAT_7 | - | - |
| NFK96_RS20190 | 4195954..4197150 | + | 1197 | WP_180492127.1 | methionine gamma-lyase | - |
| NFK96_RS20195 | 4197399..4198697 | + | 1299 | WP_148047743.1 | amino acid permease | - |
| NFK96_RS20200 | 4198713..4199924 | - | 1212 | WP_181667968.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T248504 WP_000170738.1 NZ_CP099331:c4195034-4194927 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT248504 NZ_CP099331:4195082-4195148 [Escherichia fergusonii]
GGTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
