Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-OrzO/Ldr(toxin) |
| Location | 4193962..4194181 | Replicon | chromosome |
| Accession | NZ_CP099331 | ||
| Organism | Escherichia fergusonii strain RHB44-C03 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | - |
| Locus tag | NFK96_RS20170 | Protein ID | WP_149012441.1 |
| Coordinates | 4193962..4194069 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | OrzO | ||
| Locus tag | - | ||
| Coordinates | 4194127..4194181 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK96_RS20145 (4189198) | 4189198..4189965 | - | 768 | WP_223684298.1 | cellulose biosynthesis protein BcsQ | - |
| NFK96_RS20150 (4189977) | 4189977..4190165 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
| NFK96_RS20155 (4190452) | 4190452..4192011 | + | 1560 | WP_001070267.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| NFK96_RS20160 (4192008) | 4192008..4192199 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| NFK96_RS20165 (4192196) | 4192196..4193875 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| NFK96_RS20170 (4193962) | 4193962..4194069 | - | 108 | WP_149012441.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_16 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_16 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_16 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_16 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_19 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_19 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_19 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_19 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_22 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_22 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_22 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_22 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_25 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_25 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_25 | - | Antitoxin |
| - (4194127) | 4194127..4194181 | + | 55 | NuclAT_25 | - | Antitoxin |
| - (4194127) | 4194127..4194183 | + | 57 | NuclAT_12 | - | - |
| - (4194127) | 4194127..4194183 | + | 57 | NuclAT_12 | - | - |
| - (4194127) | 4194127..4194183 | + | 57 | NuclAT_12 | - | - |
| - (4194127) | 4194127..4194183 | + | 57 | NuclAT_12 | - | - |
| - (4194127) | 4194127..4194183 | + | 57 | NuclAT_9 | - | - |
| - (4194127) | 4194127..4194183 | + | 57 | NuclAT_9 | - | - |
| - (4194127) | 4194127..4194183 | + | 57 | NuclAT_9 | - | - |
| - (4194127) | 4194127..4194183 | + | 57 | NuclAT_9 | - | - |
| NFK96_RS20175 (4194445) | 4194445..4194552 | - | 108 | WP_002431793.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| NFK96_RS20180 (4194927) | 4194927..4195034 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_15 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_15 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_15 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_15 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_18 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_18 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_18 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_18 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_21 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_21 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_21 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_21 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_24 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_24 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_24 | - | - |
| - (4195083) | 4195083..4195146 | + | 64 | NuclAT_24 | - | - |
| - (4195083) | 4195083..4195148 | + | 66 | NuclAT_11 | - | - |
| - (4195083) | 4195083..4195148 | + | 66 | NuclAT_11 | - | - |
| - (4195083) | 4195083..4195148 | + | 66 | NuclAT_11 | - | - |
| - (4195083) | 4195083..4195148 | + | 66 | NuclAT_11 | - | - |
| - (4195083) | 4195083..4195148 | + | 66 | NuclAT_8 | - | - |
| - (4195083) | 4195083..4195148 | + | 66 | NuclAT_8 | - | - |
| - (4195083) | 4195083..4195148 | + | 66 | NuclAT_8 | - | - |
| - (4195083) | 4195083..4195148 | + | 66 | NuclAT_8 | - | - |
| NFK96_RS20185 (4195410) | 4195410..4195517 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_14 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_14 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_14 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_14 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_17 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_17 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_17 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_17 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_20 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_20 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_20 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_20 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_23 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_23 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_23 | - | - |
| - (4195566) | 4195566..4195629 | + | 64 | NuclAT_23 | - | - |
| - (4195566) | 4195566..4195631 | + | 66 | NuclAT_10 | - | - |
| - (4195566) | 4195566..4195631 | + | 66 | NuclAT_10 | - | - |
| - (4195566) | 4195566..4195631 | + | 66 | NuclAT_10 | - | - |
| - (4195566) | 4195566..4195631 | + | 66 | NuclAT_10 | - | - |
| - (4195566) | 4195566..4195631 | + | 66 | NuclAT_7 | - | - |
| - (4195566) | 4195566..4195631 | + | 66 | NuclAT_7 | - | - |
| - (4195566) | 4195566..4195631 | + | 66 | NuclAT_7 | - | - |
| - (4195566) | 4195566..4195631 | + | 66 | NuclAT_7 | - | - |
| NFK96_RS20190 (4195954) | 4195954..4197150 | + | 1197 | WP_180492127.1 | methionine gamma-lyase | - |
| NFK96_RS20195 (4197399) | 4197399..4198697 | + | 1299 | WP_148047743.1 | amino acid permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3894.69 Da Isoelectric Point: 9.0157
>T248500 WP_149012441.1 NZ_CP099331:c4194069-4193962 [Escherichia fergusonii]
MTLAELGIAFWHDLAAPVITGILASMIVNWLNKRK
MTLAELGIAFWHDLAAPVITGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 55 bp
>AT248500 NZ_CP099331:4194127-4194181 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|