Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-OrzO/Ldr(toxin)
Location 4193962..4194181 Replicon chromosome
Accession NZ_CP099331
Organism Escherichia fergusonii strain RHB44-C03

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag NFK96_RS20170 Protein ID WP_149012441.1
Coordinates 4193962..4194069 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name OrzO
Locus tag -
Coordinates 4194127..4194181 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK96_RS20145 (4189198) 4189198..4189965 - 768 WP_223684298.1 cellulose biosynthesis protein BcsQ -
NFK96_RS20150 (4189977) 4189977..4190165 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
NFK96_RS20155 (4190452) 4190452..4192011 + 1560 WP_001070267.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
NFK96_RS20160 (4192008) 4192008..4192199 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
NFK96_RS20165 (4192196) 4192196..4193875 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
NFK96_RS20170 (4193962) 4193962..4194069 - 108 WP_149012441.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4194127) 4194127..4194181 + 55 NuclAT_16 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_16 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_16 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_16 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_19 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_19 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_19 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_19 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_22 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_22 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_22 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_22 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_25 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_25 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_25 - Antitoxin
- (4194127) 4194127..4194181 + 55 NuclAT_25 - Antitoxin
- (4194127) 4194127..4194183 + 57 NuclAT_12 - -
- (4194127) 4194127..4194183 + 57 NuclAT_12 - -
- (4194127) 4194127..4194183 + 57 NuclAT_12 - -
- (4194127) 4194127..4194183 + 57 NuclAT_12 - -
- (4194127) 4194127..4194183 + 57 NuclAT_9 - -
- (4194127) 4194127..4194183 + 57 NuclAT_9 - -
- (4194127) 4194127..4194183 + 57 NuclAT_9 - -
- (4194127) 4194127..4194183 + 57 NuclAT_9 - -
NFK96_RS20175 (4194445) 4194445..4194552 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
NFK96_RS20180 (4194927) 4194927..4195034 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4195083) 4195083..4195146 + 64 NuclAT_15 - -
- (4195083) 4195083..4195146 + 64 NuclAT_15 - -
- (4195083) 4195083..4195146 + 64 NuclAT_15 - -
- (4195083) 4195083..4195146 + 64 NuclAT_15 - -
- (4195083) 4195083..4195146 + 64 NuclAT_18 - -
- (4195083) 4195083..4195146 + 64 NuclAT_18 - -
- (4195083) 4195083..4195146 + 64 NuclAT_18 - -
- (4195083) 4195083..4195146 + 64 NuclAT_18 - -
- (4195083) 4195083..4195146 + 64 NuclAT_21 - -
- (4195083) 4195083..4195146 + 64 NuclAT_21 - -
- (4195083) 4195083..4195146 + 64 NuclAT_21 - -
- (4195083) 4195083..4195146 + 64 NuclAT_21 - -
- (4195083) 4195083..4195146 + 64 NuclAT_24 - -
- (4195083) 4195083..4195146 + 64 NuclAT_24 - -
- (4195083) 4195083..4195146 + 64 NuclAT_24 - -
- (4195083) 4195083..4195146 + 64 NuclAT_24 - -
- (4195083) 4195083..4195148 + 66 NuclAT_11 - -
- (4195083) 4195083..4195148 + 66 NuclAT_11 - -
- (4195083) 4195083..4195148 + 66 NuclAT_11 - -
- (4195083) 4195083..4195148 + 66 NuclAT_11 - -
- (4195083) 4195083..4195148 + 66 NuclAT_8 - -
- (4195083) 4195083..4195148 + 66 NuclAT_8 - -
- (4195083) 4195083..4195148 + 66 NuclAT_8 - -
- (4195083) 4195083..4195148 + 66 NuclAT_8 - -
NFK96_RS20185 (4195410) 4195410..4195517 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4195566) 4195566..4195629 + 64 NuclAT_14 - -
- (4195566) 4195566..4195629 + 64 NuclAT_14 - -
- (4195566) 4195566..4195629 + 64 NuclAT_14 - -
- (4195566) 4195566..4195629 + 64 NuclAT_14 - -
- (4195566) 4195566..4195629 + 64 NuclAT_17 - -
- (4195566) 4195566..4195629 + 64 NuclAT_17 - -
- (4195566) 4195566..4195629 + 64 NuclAT_17 - -
- (4195566) 4195566..4195629 + 64 NuclAT_17 - -
- (4195566) 4195566..4195629 + 64 NuclAT_20 - -
- (4195566) 4195566..4195629 + 64 NuclAT_20 - -
- (4195566) 4195566..4195629 + 64 NuclAT_20 - -
- (4195566) 4195566..4195629 + 64 NuclAT_20 - -
- (4195566) 4195566..4195629 + 64 NuclAT_23 - -
- (4195566) 4195566..4195629 + 64 NuclAT_23 - -
- (4195566) 4195566..4195629 + 64 NuclAT_23 - -
- (4195566) 4195566..4195629 + 64 NuclAT_23 - -
- (4195566) 4195566..4195631 + 66 NuclAT_10 - -
- (4195566) 4195566..4195631 + 66 NuclAT_10 - -
- (4195566) 4195566..4195631 + 66 NuclAT_10 - -
- (4195566) 4195566..4195631 + 66 NuclAT_10 - -
- (4195566) 4195566..4195631 + 66 NuclAT_7 - -
- (4195566) 4195566..4195631 + 66 NuclAT_7 - -
- (4195566) 4195566..4195631 + 66 NuclAT_7 - -
- (4195566) 4195566..4195631 + 66 NuclAT_7 - -
NFK96_RS20190 (4195954) 4195954..4197150 + 1197 WP_180492127.1 methionine gamma-lyase -
NFK96_RS20195 (4197399) 4197399..4198697 + 1299 WP_148047743.1 amino acid permease -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3894.69 Da        Isoelectric Point: 9.0157

>T248500 WP_149012441.1 NZ_CP099331:c4194069-4193962 [Escherichia fergusonii]
MTLAELGIAFWHDLAAPVITGILASMIVNWLNKRK

Download         Length: 108 bp


Antitoxin


Download         Length: 55 bp

>AT248500 NZ_CP099331:4194127-4194181 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References