Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2209873..2210435 | Replicon | chromosome |
Accession | NZ_CP099331 | ||
Organism | Escherichia fergusonii strain RHB44-C03 |
Toxin (Protein)
Gene name | higB | Uniprot ID | E9XKD5 |
Locus tag | NFK96_RS10635 | Protein ID | WP_000605673.1 |
Coordinates | 2210157..2210435 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | NFK96_RS10630 | Protein ID | WP_000781370.1 |
Coordinates | 2209873..2210157 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK96_RS10615 (2205232) | 2205232..2208279 | + | 3048 | WP_015912497.1 | formate dehydrogenase-N subunit alpha | - |
NFK96_RS10620 (2208292) | 2208292..2209176 | + | 885 | WP_001240580.1 | formate dehydrogenase N subunit beta | - |
NFK96_RS10625 (2209169) | 2209169..2209822 | + | 654 | WP_279284723.1 | formate dehydrogenase-N subunit gamma | - |
NFK96_RS10630 (2209873) | 2209873..2210157 | - | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
NFK96_RS10635 (2210157) | 2210157..2210435 | - | 279 | WP_000605673.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK96_RS10640 (2210621) | 2210621..2211631 | - | 1011 | WP_000642407.1 | alcohol dehydrogenase AdhP | - |
NFK96_RS10645 (2211766) | 2211766..2213463 | - | 1698 | WP_046082348.1 | malate dehydrogenase | - |
NFK96_RS10650 (2213620) | 2213620..2213757 | - | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
NFK96_RS10655 (2213859) | 2213859..2214074 | - | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
NFK96_RS10660 (2214418) | 2214418..2214849 | + | 432 | WP_000152305.1 | peroxiredoxin OsmC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10535.13 Da Isoelectric Point: 7.3562
>T248496 WP_000605673.1 NZ_CP099331:c2210435-2210157 [Escherichia fergusonii]
MIMNFRHKGLRDLFLLGKTSGVIPTQIKRLRHRLAVIDAASCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQIKRLRHRLAVIDAASCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L7ADF6 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2ICT | |
PDB | 2ICP | |
AlphaFold DB | A0A829CUG6 |