Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1977906..1978110 | Replicon | chromosome |
| Accession | NZ_CP099331 | ||
| Organism | Escherichia fergusonii strain RHB44-C03 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | NFK96_RS09435 | Protein ID | WP_000813255.1 |
| Coordinates | 1977955..1978110 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1977906..1977943 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK96_RS09390 | 1972954..1973172 | - | 219 | WP_001171946.1 | protein YdfC | - |
| NFK96_RS09395 | 1973244..1973543 | - | 300 | WP_044502262.1 | hypothetical protein | - |
| NFK96_RS09400 | 1973771..1974178 | - | 408 | WP_089585368.1 | helix-turn-helix domain-containing protein | - |
| NFK96_RS09405 | 1974262..1974492 | + | 231 | WP_000920567.1 | dicB transcriptional regulator DicC | - |
| NFK96_RS09410 | 1974476..1974997 | + | 522 | WP_089585367.1 | toxin YdaT family protein | - |
| NFK96_RS09415 | 1974978..1975943 | + | 966 | WP_122987173.1 | hypothetical protein | - |
| NFK96_RS09420 | 1975984..1976406 | + | 423 | WP_258808628.1 | DUF977 family protein | - |
| NFK96_RS09425 | 1976430..1976876 | + | 447 | WP_253169362.1 | class I SAM-dependent methyltransferase | - |
| NFK96_RS09430 | 1977024..1977413 | + | 390 | WP_089585364.1 | hypothetical protein | - |
| - | 1977906..1977943 | - | 38 | - | - | Antitoxin |
| NFK96_RS09435 | 1977955..1978110 | + | 156 | WP_000813255.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| NFK96_RS09440 | 1978331..1978591 | + | 261 | WP_000687436.1 | hypothetical protein | - |
| NFK96_RS09445 | 1978658..1978936 | + | 279 | WP_089585362.1 | hypothetical protein | - |
| NFK96_RS09450 | 1978938..1979984 | + | 1047 | WP_258808626.1 | DUF968 domain-containing protein | - |
| NFK96_RS09455 | 1979997..1980371 | + | 375 | WP_000904112.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NFK96_RS09460 | 1980368..1981189 | + | 822 | WP_042631004.1 | antitermination protein | - |
| NFK96_RS09465 | 1981418..1981615 | + | 198 | WP_000917767.1 | hypothetical protein | - |
| NFK96_RS09470 | 1981766..1982818 | + | 1053 | WP_258808625.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1968060..2013329 | 45269 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5726.85 Da Isoelectric Point: 6.1531
>T248495 WP_000813255.1 NZ_CP099331:1977955-1978110 [Escherichia fergusonii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE
Download Length: 156 bp
Antitoxin
Download Length: 38 bp
>AT248495 NZ_CP099331:c1977943-1977906 [Escherichia fergusonii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTG
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
