Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 986843..987089 | Replicon | chromosome |
Accession | NZ_CP099331 | ||
Organism | Escherichia fergusonii strain RHB44-C03 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | NFK96_RS04810 | Protein ID | WP_000956458.1 |
Coordinates | 986937..987089 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 986843..986895 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK96_RS04795 | 982351..984150 | + | 1800 | WP_223684922.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
NFK96_RS04800 | 984150..985862 | + | 1713 | WP_223684920.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
NFK96_RS04805 | 985936..986670 | + | 735 | WP_046083134.1 | phosphoadenosine phosphosulfate reductase | - |
- | 986843..986895 | - | 53 | - | - | Antitoxin |
NFK96_RS04810 | 986937..987089 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
NFK96_RS04815 | 987282..989982 | + | 2701 | Protein_933 | CRISPR-associated helicase Cas3' | - |
NFK96_RS04820 | 990080..991642 | + | 1563 | WP_001084117.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T248490 WP_000956458.1 NZ_CP099331:986937-987089 [Escherichia fergusonii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT248490 NZ_CP099331:c986895-986843 [Escherichia fergusonii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|