Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 663268..663526 | Replicon | chromosome |
| Accession | NZ_CP099331 | ||
| Organism | Escherichia fergusonii strain RHB44-C03 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NFK96_RS03295 | Protein ID | WP_000809168.1 |
| Coordinates | 663268..663420 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 663469..663526 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK96_RS03275 | 658334..658921 | + | 588 | WP_002431696.1 | molybdopterin adenylyltransferase | - |
| NFK96_RS03280 | 658955..659521 | - | 567 | WP_000528529.1 | acetate uptake transporter | - |
| NFK96_RS03285 | 660029..661945 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| NFK96_RS03290 | 662034..663164 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| NFK96_RS03295 | 663268..663420 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 663469..663526 | + | 58 | - | - | Antitoxin |
| NFK96_RS03300 | 663961..665127 | + | 1167 | WP_000681374.1 | Na+/H+ antiporter NhaA | - |
| NFK96_RS03305 | 665195..666094 | + | 900 | WP_000019049.1 | transcriptional activator NhaR | - |
| NFK96_RS03310 | 666190..666453 | - | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
| NFK96_RS03315 | 666556..666774 | + | 219 | WP_097343043.1 | DUF2575 family protein | - |
| NFK96_RS03320 | 666782..667723 | + | 942 | WP_042021512.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T248489 WP_000809168.1 NZ_CP099331:c663420-663268 [Escherichia fergusonii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT248489 NZ_CP099331:663469-663526 [Escherichia fergusonii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|