Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 553058..553857 | Replicon | chromosome |
| Accession | NZ_CP099331 | ||
| Organism | Escherichia fergusonii strain RHB44-C03 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | NFK96_RS02640 | Protein ID | WP_000347270.1 |
| Coordinates | 553058..553522 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | B7LMV4 |
| Locus tag | NFK96_RS02645 | Protein ID | WP_015953962.1 |
| Coordinates | 553522..553857 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK96_RS02610 (548060) | 548060..548494 | - | 435 | WP_000948832.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NFK96_RS02615 (548512) | 548512..549390 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NFK96_RS02620 (549380) | 549380..550159 | - | 780 | WP_223684419.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NFK96_RS02625 (550170) | 550170..550643 | - | 474 | WP_032303829.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NFK96_RS02630 (550666) | 550666..551946 | - | 1281 | WP_223684406.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NFK96_RS02635 (552194) | 552194..553003 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NFK96_RS02640 (553058) | 553058..553522 | - | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NFK96_RS02645 (553522) | 553522..553857 | - | 336 | WP_015953962.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NFK96_RS02650 (554006) | 554006..555577 | - | 1572 | WP_223684407.1 | galactarate dehydratase | - |
| NFK96_RS02655 (556048) | 556048..556818 | + | 771 | WP_279284675.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NFK96_RS02660 (556843) | 556843..557733 | + | 891 | WP_223684408.1 | 2-hydroxy-3-oxopropionate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T248488 WP_000347270.1 NZ_CP099331:c553522-553058 [Escherichia fergusonii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9NQ90 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | B7LMV4 |