Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 74686..75257 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP099330 | ||
| Organism | Escherichia fergusonii strain RHB44-C21 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NFL02_RS23080 | Protein ID | WP_279284509.1 |
| Coordinates | 74976..75257 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFL02_RS23075 | Protein ID | WP_279284508.1 |
| Coordinates | 74686..74967 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL02_RS23050 (NFL02_23025) | 70619..71386 | - | 768 | WP_279284502.1 | baseplate | - |
| NFL02_RS23055 (NFL02_23030) | 71383..72174 | - | 792 | WP_279284503.1 | phage tail protein | - |
| NFL02_RS23060 (NFL02_23035) | 72326..72865 | + | 540 | WP_279284504.1 | stationary phase growth adaptation protein | - |
| NFL02_RS23065 (NFL02_23040) | 73067..74272 | - | 1206 | WP_279284505.1 | phage tail protein | - |
| NFL02_RS23070 (NFL02_23045) | 74265..74594 | - | 330 | WP_279284507.1 | baseplate protein | - |
| NFL02_RS23075 (NFL02_23050) | 74686..74967 | - | 282 | WP_279284508.1 | HigA family addiction module antitoxin | Antitoxin |
| NFL02_RS23080 (NFL02_23055) | 74976..75257 | - | 282 | WP_279284509.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFL02_RS23085 (NFL02_23060) | 75592..76245 | - | 654 | WP_279284510.1 | maturation control protein | - |
| NFL02_RS23090 (NFL02_23065) | 76528..77142 | + | 615 | WP_279284511.1 | hypothetical protein | - |
| NFL02_RS23095 (NFL02_23070) | 77168..77614 | + | 447 | WP_234353651.1 | hypothetical protein | - |
| NFL02_RS23100 (NFL02_23075) | 77699..77866 | - | 168 | WP_171763956.1 | hypothetical protein | - |
| NFL02_RS23105 (NFL02_23080) | 77927..78112 | - | 186 | WP_064198788.1 | host cell division inhibitor Icd-like protein | - |
| NFL02_RS23110 (NFL02_23085) | 78354..78959 | - | 606 | WP_279284512.1 | Ref family recombination enhancement nuclease | - |
| NFL02_RS23115 (NFL02_23090) | 79080..79232 | + | 153 | WP_279284513.1 | hypothetical protein | - |
| NFL02_RS23120 (NFL02_23095) | 79232..79819 | + | 588 | WP_279284514.1 | DUF4406 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..87952 | 87952 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10590.14 Da Isoelectric Point: 10.2589
>T248487 WP_279284509.1 NZ_CP099330:c75257-74976 [Escherichia fergusonii]
MIKSFRHKGLERFFKTGTTAGIQAKHAVKLRIQLTALNAAKRPDDMSAPGWELHPLKGADLKGHWAISVNGNWRLTFRFE
GEDAILVDYQDYH
MIKSFRHKGLERFFKTGTTAGIQAKHAVKLRIQLTALNAAKRPDDMSAPGWELHPLKGADLKGHWAISVNGNWRLTFRFE
GEDAILVDYQDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|