Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4355642..4355899 | Replicon | chromosome |
Accession | NZ_CP099328 | ||
Organism | Escherichia fergusonii strain RHB44-C21 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | - |
Locus tag | NFL02_RS20880 | Protein ID | WP_001135723.1 |
Coordinates | 4355642..4355794 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 4355851..4355899 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL02_RS20850 | 4351506..4352216 | - | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
NFL02_RS20855 | 4352654..4354024 | + | 1371 | WP_279284063.1 | MFS transporter | - |
NFL02_RS20860 | 4354274..4354564 | + | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
NFL02_RS20865 | 4354846..4355058 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
NFL02_RS20870 | 4355112..4355483 | - | 372 | WP_001037803.1 | membrane protein insertion efficiency factor YidD | - |
NFL02_RS20875 | 4355594..4355665 | + | 72 | WP_216665726.1 | hypothetical protein | - |
NFL02_RS20880 | 4355642..4355794 | - | 153 | WP_001135723.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 4355851..4355899 | + | 49 | - | - | Antitoxin |
NFL02_RS20885 | 4356116..4358185 | - | 2070 | WP_001291786.1 | glycine--tRNA ligase subunit beta | - |
NFL02_RS20890 | 4358195..4359106 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
NFL02_RS20895 | 4359202..4359501 | - | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
NFL02_RS20900 | 4359673..4360668 | + | 996 | WP_279284064.1 | acyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5899.14 Da Isoelectric Point: 6.9160
>T248486 WP_001135723.1 NZ_CP099328:c4355794-4355642 [Escherichia fergusonii]
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT248486 NZ_CP099328:4355851-4355899 [Escherichia fergusonii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|