Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-sokA/Ldr(toxin)
Location 4325843..4326062 Replicon chromosome
Accession NZ_CP099328
Organism Escherichia fergusonii strain RHB44-C21

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag NFL02_RS20730 Protein ID WP_000170738.1
Coordinates 4325843..4325950 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 4325999..4326062 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFL02_RS20700 (4320893) 4320893..4321081 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
NFL02_RS20705 (4321368) 4321368..4322927 + 1560 WP_279284056.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
NFL02_RS20710 (4322924) 4322924..4323115 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
NFL02_RS20715 (4323112) 4323112..4324791 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
NFL02_RS20720 (4324878) 4324878..4324985 - 108 WP_149012441.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4325043) 4325043..4325097 + 55 NuclAT_19 - -
- (4325043) 4325043..4325097 + 55 NuclAT_19 - -
- (4325043) 4325043..4325097 + 55 NuclAT_19 - -
- (4325043) 4325043..4325097 + 55 NuclAT_19 - -
- (4325043) 4325043..4325097 + 55 NuclAT_22 - -
- (4325043) 4325043..4325097 + 55 NuclAT_22 - -
- (4325043) 4325043..4325097 + 55 NuclAT_22 - -
- (4325043) 4325043..4325097 + 55 NuclAT_22 - -
- (4325043) 4325043..4325097 + 55 NuclAT_25 - -
- (4325043) 4325043..4325097 + 55 NuclAT_25 - -
- (4325043) 4325043..4325097 + 55 NuclAT_25 - -
- (4325043) 4325043..4325097 + 55 NuclAT_25 - -
- (4325043) 4325043..4325097 + 55 NuclAT_28 - -
- (4325043) 4325043..4325097 + 55 NuclAT_28 - -
- (4325043) 4325043..4325097 + 55 NuclAT_28 - -
- (4325043) 4325043..4325097 + 55 NuclAT_28 - -
- (4325043) 4325043..4325099 + 57 NuclAT_12 - -
- (4325043) 4325043..4325099 + 57 NuclAT_12 - -
- (4325043) 4325043..4325099 + 57 NuclAT_12 - -
- (4325043) 4325043..4325099 + 57 NuclAT_12 - -
- (4325043) 4325043..4325099 + 57 NuclAT_15 - -
- (4325043) 4325043..4325099 + 57 NuclAT_15 - -
- (4325043) 4325043..4325099 + 57 NuclAT_15 - -
- (4325043) 4325043..4325099 + 57 NuclAT_15 - -
NFL02_RS20725 (4325361) 4325361..4325468 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
NFL02_RS20730 (4325843) 4325843..4325950 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4325999) 4325999..4326062 + 64 NuclAT_18 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_18 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_18 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_18 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_21 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_21 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_21 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_21 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_24 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_24 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_24 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_24 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_27 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_27 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_27 - Antitoxin
- (4325999) 4325999..4326062 + 64 NuclAT_27 - Antitoxin
- (4325999) 4325999..4326064 + 66 NuclAT_11 - -
- (4325999) 4325999..4326064 + 66 NuclAT_11 - -
- (4325999) 4325999..4326064 + 66 NuclAT_11 - -
- (4325999) 4325999..4326064 + 66 NuclAT_11 - -
- (4325999) 4325999..4326064 + 66 NuclAT_14 - -
- (4325999) 4325999..4326064 + 66 NuclAT_14 - -
- (4325999) 4325999..4326064 + 66 NuclAT_14 - -
- (4325999) 4325999..4326064 + 66 NuclAT_14 - -
NFL02_RS20735 (4326326) 4326326..4326433 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4326482) 4326482..4326545 + 64 NuclAT_17 - -
- (4326482) 4326482..4326545 + 64 NuclAT_17 - -
- (4326482) 4326482..4326545 + 64 NuclAT_17 - -
- (4326482) 4326482..4326545 + 64 NuclAT_17 - -
- (4326482) 4326482..4326545 + 64 NuclAT_20 - -
- (4326482) 4326482..4326545 + 64 NuclAT_20 - -
- (4326482) 4326482..4326545 + 64 NuclAT_20 - -
- (4326482) 4326482..4326545 + 64 NuclAT_20 - -
- (4326482) 4326482..4326545 + 64 NuclAT_23 - -
- (4326482) 4326482..4326545 + 64 NuclAT_23 - -
- (4326482) 4326482..4326545 + 64 NuclAT_23 - -
- (4326482) 4326482..4326545 + 64 NuclAT_23 - -
- (4326482) 4326482..4326545 + 64 NuclAT_26 - -
- (4326482) 4326482..4326545 + 64 NuclAT_26 - -
- (4326482) 4326482..4326545 + 64 NuclAT_26 - -
- (4326482) 4326482..4326545 + 64 NuclAT_26 - -
- (4326482) 4326482..4326547 + 66 NuclAT_10 - -
- (4326482) 4326482..4326547 + 66 NuclAT_10 - -
- (4326482) 4326482..4326547 + 66 NuclAT_10 - -
- (4326482) 4326482..4326547 + 66 NuclAT_10 - -
- (4326482) 4326482..4326547 + 66 NuclAT_13 - -
- (4326482) 4326482..4326547 + 66 NuclAT_13 - -
- (4326482) 4326482..4326547 + 66 NuclAT_13 - -
- (4326482) 4326482..4326547 + 66 NuclAT_13 - -
NFL02_RS20740 (4326869) 4326869..4328065 + 1197 WP_279284057.1 methionine gamma-lyase -
NFL02_RS20745 (4328310) 4328310..4329608 + 1299 WP_222702091.1 amino acid permease -
NFL02_RS20750 (4329624) 4329624..4330834 - 1211 Protein_4047 sigma 54-interacting transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T248482 WP_000170738.1 NZ_CP099328:c4325950-4325843 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp


Antitoxin


Download         Length: 64 bp

>AT248482 NZ_CP099328:4325999-4326062 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829L523


Antitoxin

Download structure file

References