Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-sokA/Ldr(toxin) |
Location | 4325843..4326062 | Replicon | chromosome |
Accession | NZ_CP099328 | ||
Organism | Escherichia fergusonii strain RHB44-C21 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A829L523 |
Locus tag | NFL02_RS20730 | Protein ID | WP_000170738.1 |
Coordinates | 4325843..4325950 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 4325999..4326062 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL02_RS20700 (4320893) | 4320893..4321081 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
NFL02_RS20705 (4321368) | 4321368..4322927 | + | 1560 | WP_279284056.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
NFL02_RS20710 (4322924) | 4322924..4323115 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
NFL02_RS20715 (4323112) | 4323112..4324791 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
NFL02_RS20720 (4324878) | 4324878..4324985 | - | 108 | WP_149012441.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_19 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_19 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_19 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_19 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_22 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_22 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_22 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_22 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_25 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_25 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_25 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_25 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_28 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_28 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_28 | - | - |
- (4325043) | 4325043..4325097 | + | 55 | NuclAT_28 | - | - |
- (4325043) | 4325043..4325099 | + | 57 | NuclAT_12 | - | - |
- (4325043) | 4325043..4325099 | + | 57 | NuclAT_12 | - | - |
- (4325043) | 4325043..4325099 | + | 57 | NuclAT_12 | - | - |
- (4325043) | 4325043..4325099 | + | 57 | NuclAT_12 | - | - |
- (4325043) | 4325043..4325099 | + | 57 | NuclAT_15 | - | - |
- (4325043) | 4325043..4325099 | + | 57 | NuclAT_15 | - | - |
- (4325043) | 4325043..4325099 | + | 57 | NuclAT_15 | - | - |
- (4325043) | 4325043..4325099 | + | 57 | NuclAT_15 | - | - |
NFL02_RS20725 (4325361) | 4325361..4325468 | - | 108 | WP_002431793.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
NFL02_RS20730 (4325843) | 4325843..4325950 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_18 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_18 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_18 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_18 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_21 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_21 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_21 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_21 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_24 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_24 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_24 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_24 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_27 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_27 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_27 | - | Antitoxin |
- (4325999) | 4325999..4326062 | + | 64 | NuclAT_27 | - | Antitoxin |
- (4325999) | 4325999..4326064 | + | 66 | NuclAT_11 | - | - |
- (4325999) | 4325999..4326064 | + | 66 | NuclAT_11 | - | - |
- (4325999) | 4325999..4326064 | + | 66 | NuclAT_11 | - | - |
- (4325999) | 4325999..4326064 | + | 66 | NuclAT_11 | - | - |
- (4325999) | 4325999..4326064 | + | 66 | NuclAT_14 | - | - |
- (4325999) | 4325999..4326064 | + | 66 | NuclAT_14 | - | - |
- (4325999) | 4325999..4326064 | + | 66 | NuclAT_14 | - | - |
- (4325999) | 4325999..4326064 | + | 66 | NuclAT_14 | - | - |
NFL02_RS20735 (4326326) | 4326326..4326433 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_17 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_17 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_17 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_17 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_20 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_20 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_20 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_20 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_23 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_23 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_23 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_23 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_26 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_26 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_26 | - | - |
- (4326482) | 4326482..4326545 | + | 64 | NuclAT_26 | - | - |
- (4326482) | 4326482..4326547 | + | 66 | NuclAT_10 | - | - |
- (4326482) | 4326482..4326547 | + | 66 | NuclAT_10 | - | - |
- (4326482) | 4326482..4326547 | + | 66 | NuclAT_10 | - | - |
- (4326482) | 4326482..4326547 | + | 66 | NuclAT_10 | - | - |
- (4326482) | 4326482..4326547 | + | 66 | NuclAT_13 | - | - |
- (4326482) | 4326482..4326547 | + | 66 | NuclAT_13 | - | - |
- (4326482) | 4326482..4326547 | + | 66 | NuclAT_13 | - | - |
- (4326482) | 4326482..4326547 | + | 66 | NuclAT_13 | - | - |
NFL02_RS20740 (4326869) | 4326869..4328065 | + | 1197 | WP_279284057.1 | methionine gamma-lyase | - |
NFL02_RS20745 (4328310) | 4328310..4329608 | + | 1299 | WP_222702091.1 | amino acid permease | - |
NFL02_RS20750 (4329624) | 4329624..4330834 | - | 1211 | Protein_4047 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T248482 WP_000170738.1 NZ_CP099328:c4325950-4325843 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 64 bp
>AT248482 NZ_CP099328:4325999-4326062 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|