Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1209296..1209975 | Replicon | chromosome |
| Accession | NZ_CP099328 | ||
| Organism | Escherichia fergusonii strain RHB44-C21 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B7LJF3 |
| Locus tag | NFL02_RS05915 | Protein ID | WP_002431667.1 |
| Coordinates | 1209296..1209598 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFL02_RS05920 | Protein ID | WP_000806441.1 |
| Coordinates | 1209634..1209975 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL02_RS05890 (1204672) | 1204672..1206324 | + | 1653 | WP_196082122.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| NFL02_RS05895 (1206362) | 1206362..1206865 | - | 504 | WP_279284275.1 | hypothetical protein | - |
| NFL02_RS05900 (1206862) | 1206862..1207662 | - | 801 | WP_000439795.1 | hypothetical protein | - |
| NFL02_RS05905 (1207686) | 1207686..1208165 | - | 480 | WP_000186629.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| NFL02_RS05910 (1208369) | 1208369..1209163 | - | 795 | WP_046082796.1 | TraB/GumN family protein | - |
| NFL02_RS05915 (1209296) | 1209296..1209598 | + | 303 | WP_002431667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFL02_RS05920 (1209634) | 1209634..1209975 | + | 342 | WP_000806441.1 | HigA family addiction module antitoxin | Antitoxin |
| NFL02_RS05925 (1210089) | 1210089..1212593 | - | 2505 | WP_279284276.1 | copper-exporting P-type ATPase CopA | - |
| NFL02_RS05930 (1212900) | 1212900..1214188 | + | 1289 | Protein_1144 | APC family permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11811.37 Da Isoelectric Point: 10.1572
>T248468 WP_002431667.1 NZ_CP099328:1209296-1209598 [Escherichia fergusonii]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELYLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELYLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|