Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 702100..702358 | Replicon | chromosome |
Accession | NZ_CP099328 | ||
Organism | Escherichia fergusonii strain RHB44-C21 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | - |
Locus tag | NFL02_RS03495 | Protein ID | WP_197970443.1 |
Coordinates | 702100..702252 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 702301..702358 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL02_RS03475 | 697165..697752 | + | 588 | WP_002431696.1 | molybdopterin adenylyltransferase | - |
NFL02_RS03480 | 697786..698352 | - | 567 | WP_000528529.1 | acetate uptake transporter | - |
NFL02_RS03485 | 698860..700776 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
NFL02_RS03490 | 700865..701995 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
NFL02_RS03495 | 702100..702252 | - | 153 | WP_197970443.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 702301..702358 | + | 58 | - | - | Antitoxin |
NFL02_RS03500 | 702793..703959 | + | 1167 | WP_000681374.1 | Na+/H+ antiporter NhaA | - |
NFL02_RS03505 | 704027..704926 | + | 900 | WP_000019049.1 | transcriptional activator NhaR | - |
NFL02_RS03510 | 705022..705285 | - | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
NFL02_RS03515 | 705388..705606 | + | 219 | WP_181198726.1 | DUF2575 domain-containing protein | - |
NFL02_RS03520 | 705614..706555 | + | 942 | WP_046081994.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T248465 WP_197970443.1 NZ_CP099328:c702252-702100 [Escherichia fergusonii]
MKQHKAMIVALIVICVTAIVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICVTAIVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT248465 NZ_CP099328:702301-702358 [Escherichia fergusonii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|