Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4451196..4451798 | Replicon | chromosome |
Accession | NZ_CP099323 | ||
Organism | Enterobacter hormaechei strain RHB45-SO-C08 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFL40_RS21060 | Protein ID | WP_045308723.1 |
Coordinates | 4451487..4451798 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFL40_RS21055 | Protein ID | WP_032626927.1 |
Coordinates | 4451196..4451486 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL40_RS21040 (NFL40_21030) | 4448694..4449596 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
NFL40_RS21045 (NFL40_21035) | 4449593..4450228 | + | 636 | WP_006808711.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFL40_RS21050 (NFL40_21040) | 4450225..4451154 | + | 930 | WP_022649835.1 | formate dehydrogenase accessory protein FdhE | - |
NFL40_RS21055 (NFL40_21045) | 4451196..4451486 | - | 291 | WP_032626927.1 | NadS family protein | Antitoxin |
NFL40_RS21060 (NFL40_21050) | 4451487..4451798 | - | 312 | WP_045308723.1 | toxin HigB-2 | Toxin |
NFL40_RS21065 (NFL40_21055) | 4451947..4452888 | - | 942 | WP_022649838.1 | fatty acid biosynthesis protein FabY | - |
NFL40_RS21070 (NFL40_21060) | 4452933..4453370 | - | 438 | WP_048965998.1 | D-aminoacyl-tRNA deacylase | - |
NFL40_RS21075 (NFL40_21065) | 4453367..4454248 | - | 882 | WP_225303555.1 | virulence factor BrkB family protein | - |
NFL40_RS21080 (NFL40_21070) | 4454242..4454841 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
NFL40_RS21085 (NFL40_21075) | 4454960..4455760 | - | 801 | WP_048965999.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NFL40_RS21090 (NFL40_21080) | 4455795..4456691 | - | 897 | WP_048966000.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12134.10 Da Isoelectric Point: 9.4455
>T248449 WP_045308723.1 NZ_CP099323:c4451798-4451487 [Enterobacter hormaechei]
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPDYGDLIQNSGGLRKIRWLAGGKGKRSGVRVIYFHRTRECEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPDYGDLIQNSGGLRKIRWLAGGKGKRSGVRVIYFHRTRECEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|