Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 71150..71796 | Replicon | chromosome |
| Accession | NZ_CP099308 | ||
| Organism | Enterobacter roggenkampii strain RHB21-E1-C01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NFK08_RS00315 | Protein ID | WP_045907956.1 |
| Coordinates | 71446..71796 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A8B2S8A5 |
| Locus tag | NFK08_RS00310 | Protein ID | WP_045337168.1 |
| Coordinates | 71150..71449 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK08_RS00280 (NFK08_00280) | 66552..67511 | - | 960 | WP_023345179.1 | DUF523 and DUF1722 domain-containing protein | - |
| NFK08_RS00285 (NFK08_00285) | 67614..68024 | - | 411 | WP_008500117.1 | hydroxyisourate hydrolase | - |
| NFK08_RS00290 (NFK08_00290) | 68124..68849 | - | 726 | WP_008500116.1 | MerR family transcriptional regulator | - |
| NFK08_RS00295 (NFK08_00295) | 68967..69491 | + | 525 | WP_008500115.1 | lipocalin family protein | - |
| NFK08_RS00300 (NFK08_00300) | 69570..70616 | + | 1047 | WP_219284395.1 | class I SAM-dependent methyltransferase | - |
| NFK08_RS00305 (NFK08_00305) | 70683..71120 | + | 438 | WP_045337169.1 | acetyltransferase | - |
| NFK08_RS00310 (NFK08_00310) | 71150..71449 | - | 300 | WP_045337168.1 | XRE family transcriptional regulator | Antitoxin |
| NFK08_RS00315 (NFK08_00315) | 71446..71796 | - | 351 | WP_045907956.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK08_RS00320 (NFK08_00320) | 72225..72566 | - | 342 | WP_219284394.1 | SymE family type I addiction module toxin | - |
| NFK08_RS00325 (NFK08_00325) | 72695..72856 | + | 162 | WP_219284393.1 | YlcI/YnfO family protein | - |
| NFK08_RS00330 (NFK08_00330) | 72928..75015 | + | 2088 | WP_248199279.1 | ATP-binding domain-containing protein | - |
| NFK08_RS00335 (NFK08_00335) | 75012..75710 | + | 699 | WP_219284392.1 | DUF2290 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13568.61 Da Isoelectric Point: 9.3787
>T248370 WP_045907956.1 NZ_CP099308:c71796-71446 [Enterobacter roggenkampii]
MWTVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKELRIQYAGRPVRAFFAFDPVRQAI
VLCAGDKSNDKTFYEKMIRIADAEFSLHLTSQEAAK
MWTVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKELRIQYAGRPVRAFFAFDPVRQAI
VLCAGDKSNDKTFYEKMIRIADAEFSLHLTSQEAAK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|