Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2359492..2360054 | Replicon | chromosome |
| Accession | NZ_CP099303 | ||
| Organism | Citrobacter freundii strain RHB02-E1-C01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NFJ16_RS11220 | Protein ID | WP_032936429.1 |
| Coordinates | 2359776..2360054 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A8B5QC60 |
| Locus tag | NFJ16_RS11215 | Protein ID | WP_003836231.1 |
| Coordinates | 2359492..2359776 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ16_RS11200 (2357183) | 2357183..2358067 | + | 885 | WP_003833024.1 | formate dehydrogenase N subunit beta | - |
| NFJ16_RS11205 (2358060) | 2358060..2358716 | + | 657 | WP_003020054.1 | formate dehydrogenase-N subunit gamma | - |
| NFJ16_RS11210 (2358846) | 2358846..2359448 | + | 603 | WP_032935729.1 | inorganic diphosphatase | - |
| NFJ16_RS11215 (2359492) | 2359492..2359776 | - | 285 | WP_003836231.1 | HigA family addiction module antitoxin | Antitoxin |
| NFJ16_RS11220 (2359776) | 2359776..2360054 | - | 279 | WP_032936429.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFJ16_RS11225 (2360275) | 2360275..2361990 | - | 1716 | WP_032935731.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| NFJ16_RS11230 (2362300) | 2362300..2363997 | - | 1698 | WP_003020042.1 | malate dehydrogenase | - |
| NFJ16_RS11235 (2364177) | 2364177..2364317 | - | 141 | WP_003020039.1 | stationary-phase-induced ribosome-associated protein | - |
| NFJ16_RS11240 (2364545) | 2364545..2364976 | + | 432 | WP_003020036.1 | peroxiredoxin OsmC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10667.30 Da Isoelectric Point: 9.8965
>T248340 WP_032936429.1 NZ_CP099303:c2360054-2359776 [Citrobacter freundii]
MIMNFRHKGLRDLFLHGRTSGVMAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGDRDGIWAITVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLHGRTSGVMAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGDRDGIWAITVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|