Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 23490..24217 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099261 | ||
| Organism | Klebsiella aerogenes strain RHB08-SO-C04 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | NFJ54_RS25835 | Protein ID | WP_011251285.1 |
| Coordinates | 23490..23801 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFJ54_RS25840 | Protein ID | WP_011251286.1 |
| Coordinates | 23798..24217 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ54_RS25805 (NFJ54_25775) | 19330..20340 | + | 1011 | WP_221028696.1 | LacI family DNA-binding transcriptional regulator | - |
| NFJ54_RS25810 (NFJ54_25780) | 20451..20921 | - | 471 | WP_235891748.1 | heme-binding protein | - |
| NFJ54_RS25815 (NFJ54_25785) | 20872..21783 | - | 912 | WP_221028695.1 | dihydrodipicolinate synthase family protein | - |
| NFJ54_RS25820 (NFJ54_25790) | 21777..21899 | - | 123 | Protein_20 | SDR family oxidoreductase | - |
| NFJ54_RS25830 (NFJ54_25800) | 22671..23285 | + | 615 | Protein_22 | IS3-like element ISEc27 family transposase | - |
| NFJ54_RS25835 (NFJ54_25805) | 23490..23801 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NFJ54_RS25840 (NFJ54_25810) | 23798..24217 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NFJ54_RS25845 (NFJ54_25815) | 24287..24460 | + | 174 | WP_221028715.1 | hypothetical protein | - |
| NFJ54_RS25850 (NFJ54_25820) | 24574..25590 | + | 1017 | Protein_26 | L-lactate permease | - |
| NFJ54_RS25855 (NFJ54_25825) | 25789..26757 | + | 969 | Protein_27 | IS5-like element IS903B family transposase | - |
| NFJ54_RS25860 | 26783..26914 | - | 132 | WP_279281583.1 | hypothetical protein | - |
| NFJ54_RS25865 (NFJ54_25830) | 26916..27134 | - | 219 | WP_279281584.1 | TraK | - |
| NFJ54_RS25870 (NFJ54_25835) | 27156..28276 | + | 1121 | WP_279281135.1 | IS3 family transposase | - |
| NFJ54_RS25875 (NFJ54_25840) | 28334..28531 | + | 198 | Protein_31 | hypothetical protein | - |
| NFJ54_RS25880 (NFJ54_25845) | 28534..29079 | - | 546 | WP_112029143.1 | winged helix DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..183022 | 183022 | |
| - | inside | IScluster/Tn | - | - | 21916..28276 | 6360 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T248300 WP_011251285.1 NZ_CP099261:23490-23801 [Klebsiella aerogenes]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT248300 WP_011251286.1 NZ_CP099261:23798-24217 [Klebsiella aerogenes]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|