Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 339581..340227 | Replicon | chromosome |
Accession | NZ_CP099260 | ||
Organism | Klebsiella aerogenes strain RHB08-SO-C04 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFJ54_RS01575 | Protein ID | WP_045394830.1 |
Coordinates | 339581..339928 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFJ54_RS01580 | Protein ID | WP_045394831.1 |
Coordinates | 339928..340227 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ54_RS01565 (NFJ54_01565) | 335465..336898 | + | 1434 | WP_015369346.1 | glycogen synthase GlgA | - |
NFJ54_RS01570 (NFJ54_01570) | 336916..339363 | + | 2448 | WP_015369347.1 | glycogen phosphorylase | - |
NFJ54_RS01575 (NFJ54_01575) | 339581..339928 | + | 348 | WP_045394830.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ54_RS01580 (NFJ54_01580) | 339928..340227 | + | 300 | WP_045394831.1 | XRE family transcriptional regulator | Antitoxin |
NFJ54_RS01585 (NFJ54_01585) | 340573..342081 | - | 1509 | WP_279281335.1 | glycerol-3-phosphate dehydrogenase | - |
NFJ54_RS01590 (NFJ54_01590) | 342288..342617 | + | 330 | WP_015369349.1 | thiosulfate sulfurtransferase GlpE | - |
NFJ54_RS01595 (NFJ54_01595) | 342670..343500 | + | 831 | WP_049035296.1 | rhomboid family intramembrane serine protease GlpG | - |
NFJ54_RS01600 (NFJ54_01600) | 343520..344278 | + | 759 | WP_015369351.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13489.55 Da Isoelectric Point: 7.2785
>T248289 WP_045394830.1 NZ_CP099260:339581-339928 [Klebsiella aerogenes]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKGSKFQNMKELRVQHHGLPVRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKGSKFQNMKELRVQHHGLPVRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|