Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4703647..4704246 | Replicon | chromosome |
| Accession | NZ_CP099254 | ||
| Organism | Citrobacter freundii strain RHB09-E3-C07 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NFJ59_RS22115 | Protein ID | WP_100193804.1 |
| Coordinates | 4703935..4704246 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFJ59_RS22110 | Protein ID | WP_079939299.1 |
| Coordinates | 4703647..4703934 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ59_RS22095 (4701143) | 4701143..4702045 | + | 903 | WP_115259809.1 | formate dehydrogenase O subunit beta | - |
| NFJ59_RS22100 (4702042) | 4702042..4702677 | + | 636 | WP_096758858.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFJ59_RS22105 (4702674) | 4702674..4703603 | + | 930 | WP_096758859.1 | formate dehydrogenase accessory protein FdhE | - |
| NFJ59_RS22110 (4703647) | 4703647..4703934 | - | 288 | WP_079939299.1 | NadS family protein | Antitoxin |
| NFJ59_RS22115 (4703935) | 4703935..4704246 | - | 312 | WP_100193804.1 | toxin HigB-2 | Toxin |
| NFJ59_RS22120 (4704467) | 4704467..4705381 | + | 915 | WP_279277428.1 | alpha/beta hydrolase | - |
| NFJ59_RS22125 (4705420) | 4705420..4706361 | - | 942 | WP_181618151.1 | fatty acid biosynthesis protein FabY | - |
| NFJ59_RS22130 (4706406) | 4706406..4706843 | - | 438 | WP_181618152.1 | D-aminoacyl-tRNA deacylase | - |
| NFJ59_RS22135 (4706840) | 4706840..4707712 | - | 873 | WP_181618153.1 | virulence factor BrkB family protein | - |
| NFJ59_RS22140 (4707706) | 4707706..4708305 | - | 600 | WP_096758866.1 | glucose-1-phosphatase | - |
| NFJ59_RS22145 (4708411) | 4708411..4709214 | - | 804 | WP_279277429.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12261.38 Da Isoelectric Point: 10.0972
>T248285 WP_100193804.1 NZ_CP099254:c4704246-4703935 [Citrobacter freundii]
MLFIETEIFTEDVKKLLDDDEYRRLQIFLTIQPDCGDLIQDTGGLRKVRWRARGKGKRGGVRIIYFHQIRKSQIRLLLIY
QKGIKDDLTPQEKVLLRMLNEGW
MLFIETEIFTEDVKKLLDDDEYRRLQIFLTIQPDCGDLIQDTGGLRKVRWRARGKGKRGGVRIIYFHQIRKSQIRLLLIY
QKGIKDDLTPQEKVLLRMLNEGW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|