Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 362690..363356 | Replicon | chromosome |
Accession | NZ_CP099254 | ||
Organism | Citrobacter freundii strain RHB09-E3-C07 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFJ59_RS01745 | Protein ID | WP_117342464.1 |
Coordinates | 363039..363356 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | NFJ59_RS01740 | Protein ID | WP_003837894.1 |
Coordinates | 362690..362986 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ59_RS01725 (359864) | 359864..360337 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
NFJ59_RS01730 (360564) | 360564..361283 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
NFJ59_RS01735 (361280) | 361280..362632 | + | 1353 | WP_096759268.1 | two-component system sensor histidine kinase EnvZ | - |
NFJ59_RS01740 (362690) | 362690..362986 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
NFJ59_RS01745 (363039) | 363039..363356 | - | 318 | WP_117342464.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ59_RS01750 (363480) | 363480..365102 | - | 1623 | WP_182270802.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
NFJ59_RS01755 (365481) | 365481..367199 | + | 1719 | WP_182270803.1 | DUF4153 domain-containing protein | - |
NFJ59_RS01760 (367250) | 367250..368128 | - | 879 | WP_181618419.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12226.13 Da Isoelectric Point: 9.8310
>T248274 WP_117342464.1 NZ_CP099254:c363356-363039 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSDMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSDMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|