Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 32633..33283 | Replicon | chromosome |
| Accession | NZ_CP099254 | ||
| Organism | Citrobacter freundii strain RHB09-E3-C07 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NFJ59_RS00165 | Protein ID | WP_279277480.1 |
| Coordinates | 32633..32974 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFJ59_RS00170 | Protein ID | WP_182270704.1 |
| Coordinates | 32984..33283 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ59_RS00145 (29032) | 29032..30423 | + | 1392 | WP_182270702.1 | hexose-6-phosphate:phosphate antiporter | - |
| NFJ59_RS00150 (30467) | 30467..31372 | - | 906 | WP_181618244.1 | LysR family transcriptional regulator | - |
| NFJ59_RS00155 (31478) | 31478..31930 | + | 453 | WP_182270703.1 | DUF1198 family protein | - |
| NFJ59_RS00160 (32030) | 32030..32554 | + | 525 | WP_181618246.1 | SRPBCC domain-containing protein | - |
| NFJ59_RS00165 (32633) | 32633..32974 | + | 342 | WP_279277480.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFJ59_RS00170 (32984) | 32984..33283 | + | 300 | WP_182270704.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NFJ59_RS00175 (33403) | 33403..34596 | + | 1194 | WP_181618249.1 | purine ribonucleoside efflux pump NepI | - |
| NFJ59_RS00180 (34704) | 34704..36080 | - | 1377 | WP_181618250.1 | carbohydrate porin | - |
| NFJ59_RS00185 (36288) | 36288..36590 | - | 303 | WP_008786514.1 | PTS lactose/cellobiose transporter subunit IIA | - |
| NFJ59_RS00190 (36603) | 36603..37985 | - | 1383 | WP_182270705.1 | glycoside hydrolase family 1 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13045.87 Da Isoelectric Point: 6.2275
>T248271 WP_279277480.1 NZ_CP099254:32633-32974 [Citrobacter freundii]
MWDVETTDAFDKWFDVQTEAFKEDMLAAMMILSEYGPQLGRPFADTVNDSAFSNMKELRVQHQGNPIRAFFAFDPSRHGI
VLCAGGKTGINEKKFYKDMIKFADVEYRKHLNK
MWDVETTDAFDKWFDVQTEAFKEDMLAAMMILSEYGPQLGRPFADTVNDSAFSNMKELRVQHQGNPIRAFFAFDPSRHGI
VLCAGGKTGINEKKFYKDMIKFADVEYRKHLNK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|