Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3833600..3834197 | Replicon | chromosome |
| Accession | NZ_CP099140 | ||
| Organism | Klebsiella pneumoniae strain RHB28-SO-C05 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | NFK38_RS18870 | Protein ID | WP_004142563.1 |
| Coordinates | 3833880..3834197 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | NFK38_RS18865 | Protein ID | WP_004142561.1 |
| Coordinates | 3833600..3833887 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK38_RS18840 (NFK38_18825) | 3828870..3829985 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| NFK38_RS18845 (NFK38_18830) | 3830165..3830746 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| NFK38_RS18850 (NFK38_18835) | 3830746..3831114 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| NFK38_RS18855 (NFK38_18840) | 3831234..3831887 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| NFK38_RS18860 (NFK38_18845) | 3832074..3833436 | + | 1363 | Protein_3696 | IS3-like element ISKpn1 family transposase | - |
| NFK38_RS18865 (NFK38_18850) | 3833600..3833887 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NFK38_RS18870 (NFK38_18855) | 3833880..3834197 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK38_RS18875 (NFK38_18860) | 3834382..3835425 | - | 1044 | WP_023284821.1 | DUF2157 domain-containing protein | - |
| NFK38_RS18880 (NFK38_18865) | 3836095..3836961 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| NFK38_RS18885 (NFK38_18870) | 3837070..3838497 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T248223 WP_004142563.1 NZ_CP099140:c3834197-3833880 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |