Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 333952..334618 | Replicon | chromosome |
Accession | NZ_CP099128 | ||
Organism | Citrobacter freundii strain RHB31-E4-C06 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8B5Q945 |
Locus tag | NFK47_RS01575 | Protein ID | WP_003847996.1 |
Coordinates | 334301..334618 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | NFK47_RS01570 | Protein ID | WP_003837894.1 |
Coordinates | 333952..334248 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK47_RS01555 (331128) | 331128..331601 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
NFK47_RS01560 (331827) | 331827..332546 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
NFK47_RS01565 (332543) | 332543..333895 | + | 1353 | WP_003837891.1 | two-component system sensor histidine kinase EnvZ | - |
NFK47_RS01570 (333952) | 333952..334248 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
NFK47_RS01575 (334301) | 334301..334618 | - | 318 | WP_003847996.1 | hypothetical protein | Toxin |
NFK47_RS01580 (334741) | 334741..336363 | - | 1623 | WP_003023529.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
NFK47_RS01585 (336742) | 336742..338460 | + | 1719 | WP_046671282.1 | DUF4153 domain-containing protein | - |
NFK47_RS01590 (338570) | 338570..339448 | - | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12225.15 Da Isoelectric Point: 10.0909
>T248203 WP_003847996.1 NZ_CP099128:c334618-334301 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B5Q945 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U6IRD5 |