Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 365677..366343 | Replicon | chromosome |
Accession | NZ_CP099084 | ||
Organism | Citrobacter freundii strain RHB43-C17 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFK79_RS01695 | Protein ID | WP_181498852.1 |
Coordinates | 366026..366343 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | NFK79_RS01690 | Protein ID | WP_003837894.1 |
Coordinates | 365677..365973 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK79_RS01675 (362853) | 362853..363326 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
NFK79_RS01680 (363553) | 363553..364272 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
NFK79_RS01685 (364269) | 364269..365621 | + | 1353 | WP_096759268.1 | two-component system sensor histidine kinase EnvZ | - |
NFK79_RS01690 (365677) | 365677..365973 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
NFK79_RS01695 (366026) | 366026..366343 | - | 318 | WP_181498852.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK79_RS01700 (366467) | 366467..368089 | - | 1623 | WP_096759270.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
NFK79_RS01705 (368468) | 368468..370186 | + | 1719 | WP_096759271.1 | DUF4153 domain-containing protein | - |
NFK79_RS01710 (370237) | 370237..371115 | - | 879 | WP_096759272.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12229.08 Da Isoelectric Point: 8.4447
>T248184 WP_181498852.1 NZ_CP099084:c366343-366026 [Citrobacter freundii]
MFTFIELQGFSKRSPLLLPDDEFRAFQEALIENPEAGDTIAGTEGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSDMLI
MFTFIELQGFSKRSPLLLPDDEFRAFQEALIENPEAGDTIAGTEGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSDMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|