Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 335504..336170 | Replicon | chromosome |
Accession | NZ_CP099037 | ||
Organism | Citrobacter freundii strain RHB44-SO-C05 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8B5Q945 |
Locus tag | NFL15_RS01550 | Protein ID | WP_003847996.1 |
Coordinates | 335853..336170 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFL15_RS01545 | Protein ID | WP_049001470.1 |
Coordinates | 335504..335800 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL15_RS01530 (332680) | 332680..333153 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
NFL15_RS01535 (333379) | 333379..334098 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
NFL15_RS01540 (334095) | 334095..335447 | + | 1353 | WP_003837891.1 | two-component system sensor histidine kinase EnvZ | - |
NFL15_RS01545 (335504) | 335504..335800 | - | 297 | WP_049001470.1 | NadS family protein | Antitoxin |
NFL15_RS01550 (335853) | 335853..336170 | - | 318 | WP_003847996.1 | hypothetical protein | Toxin |
NFL15_RS01555 (336293) | 336293..337915 | - | 1623 | WP_003023529.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
NFL15_RS01560 (338294) | 338294..340012 | + | 1719 | WP_061549613.1 | DUF4153 domain-containing protein | - |
NFL15_RS01565 (340122) | 340122..341000 | - | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12225.15 Da Isoelectric Point: 10.0909
>T248173 WP_003847996.1 NZ_CP099037:c336170-335853 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|