Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 38900..39548 | Replicon | chromosome |
Accession | NZ_CP099037 | ||
Organism | Citrobacter freundii strain RHB44-SO-C05 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFL15_RS00180 | Protein ID | WP_049000674.1 |
Coordinates | 38900..39262 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFL15_RS00185 | Protein ID | WP_049000676.1 |
Coordinates | 39249..39548 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL15_RS00165 (35359) | 35359..36687 | + | 1329 | WP_003023927.1 | MFS transporter | - |
NFL15_RS00170 (36830) | 36830..38221 | + | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
NFL15_RS00175 (38347) | 38347..38799 | + | 453 | WP_003023933.1 | DUF1198 family protein | - |
NFL15_RS00180 (38900) | 38900..39262 | + | 363 | WP_049000674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFL15_RS00185 (39249) | 39249..39548 | + | 300 | WP_049000676.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NFL15_RS00190 (39667) | 39667..40860 | + | 1194 | WP_003840662.1 | purine ribonucleoside efflux pump NepI | - |
NFL15_RS00195 (40910) | 40910..42292 | - | 1383 | WP_139935879.1 | glycoside hydrolase family 1 protein | - |
NFL15_RS00200 (42387) | 42387..42680 | - | 294 | WP_003840665.1 | YicS family protein | - |
NFL15_RS00205 (42811) | 42811..43227 | + | 417 | WP_003023951.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13716.59 Da Isoelectric Point: 5.6550
>T248172 WP_049000674.1 NZ_CP099037:38900-39262 [Citrobacter freundii]
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKGLRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKGLRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|