Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 122674..123331 | Replicon | chromosome |
Accession | NZ_CP098926 | ||
Organism | Halomonas sp. MS1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NF683_RS00545 | Protein ID | WP_095603866.1 |
Coordinates | 122674..123018 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NF683_RS00550 | Protein ID | WP_193067530.1 |
Coordinates | 123029..123331 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF683_RS00520 (NF683_00520) | 118369..118770 | - | 402 | WP_253921916.1 | PaaI family thioesterase | - |
NF683_RS00525 (NF683_00525) | 118833..119459 | - | 627 | WP_125750324.1 | LysE family translocator | - |
NF683_RS00530 (NF683_00530) | 119746..121170 | - | 1425 | WP_253920990.1 | diguanylate cyclase | - |
NF683_RS00535 (NF683_00535) | 121604..121891 | - | 288 | WP_089039439.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
NF683_RS00540 (NF683_00540) | 122042..122377 | - | 336 | WP_089039441.1 | zinc ribbon domain-containing protein YjdM | - |
NF683_RS00545 (NF683_00545) | 122674..123018 | + | 345 | WP_095603866.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF683_RS00550 (NF683_00550) | 123029..123331 | + | 303 | WP_193067530.1 | XRE family transcriptional regulator | Antitoxin |
NF683_RS00555 (NF683_00555) | 123399..125012 | - | 1614 | WP_253920991.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
NF683_RS00560 (NF683_00560) | 125224..126357 | - | 1134 | WP_253920992.1 | MFS transporter | - |
NF683_RS00565 (NF683_00565) | 126502..127389 | + | 888 | WP_253920993.1 | LysR substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13203.03 Da Isoelectric Point: 6.2305
>T248167 WP_095603866.1 NZ_CP098926:122674-123018 [Halomonas sp. MS1]
MWSIEQTDTFEAWFFSLEEIERENVLASVLLLRERGPMLSRPHADTVNGSQHSNMKELRVQCQGRPIRVFFAFDPRRTGI
LLCAGDKGGNDKRFYNEMIPVADKEYTAHLETLK
MWSIEQTDTFEAWFFSLEEIERENVLASVLLLRERGPMLSRPHADTVNGSQHSNMKELRVQCQGRPIRVFFAFDPRRTGI
LLCAGDKGGNDKRFYNEMIPVADKEYTAHLETLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|