Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4769130..4769884 | Replicon | chromosome |
| Accession | NZ_CP098834 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain GD19PS1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NFH28_RS23390 | Protein ID | WP_000558166.1 |
| Coordinates | 4769130..4769441 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFH28_RS23395 | Protein ID | WP_001259011.1 |
| Coordinates | 4769438..4769884 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFH28_RS23360 (4764788) | 4764788..4765690 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NFH28_RS23365 (4765687) | 4765687..4766322 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFH28_RS23370 (4766319) | 4766319..4767248 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NFH28_RS23375 (4767295) | 4767295..4767585 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NFH28_RS23380 (4767586) | 4767586..4767897 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NFH28_RS23385 (4768115) | 4768115..4769044 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NFH28_RS23390 (4769130) | 4769130..4769441 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NFH28_RS23395 (4769438) | 4769438..4769884 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NFH28_RS23400 (4769899) | 4769899..4770840 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NFH28_RS23405 (4770885) | 4770885..4771322 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NFH28_RS23410 (4771319) | 4771319..4772191 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NFH28_RS23415 (4772185) | 4772185..4772784 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NFH28_RS23420 (4772975) | 4772975..4773778 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NFH28_RS23425 (4773812) | 4773812..4774708 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T248164 WP_000558166.1 NZ_CP098834:4769130-4769441 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT248164 WP_001259011.1 NZ_CP098834:4769438-4769884 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|