Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2447822..2448344 | Replicon | chromosome |
Accession | NZ_CP098834 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain GD19PS1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NFH28_RS12055 | Protein ID | WP_000221343.1 |
Coordinates | 2448060..2448344 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NFH28_RS12050 | Protein ID | WP_000885424.1 |
Coordinates | 2447822..2448070 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFH28_RS12025 (2443038) | 2443038..2444504 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NFH28_RS12030 (2445312) | 2445312..2446026 | + | 715 | Protein_2360 | helix-turn-helix domain-containing protein | - |
NFH28_RS12035 (2446082) | 2446082..2446990 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NFH28_RS12040 (2447133) | 2447133..2447465 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NFH28_RS12045 (2447455) | 2447455..2447670 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NFH28_RS12050 (2447822) | 2447822..2448070 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NFH28_RS12055 (2448060) | 2448060..2448344 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFH28_RS12060 (2448515) | 2448515..2448904 | + | 390 | WP_000194089.1 | RidA family protein | - |
NFH28_RS12065 (2448956) | 2448956..2450035 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NFH28_RS12070 (2450228) | 2450228..2450716 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NFH28_RS12075 (2450761) | 2450761..2452269 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2443041..2455126 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T248156 WP_000221343.1 NZ_CP098834:2448060-2448344 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |