Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4616962..4617716 | Replicon | chromosome |
| Accession | NZ_CP098831 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS14 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4Y6MJG6 |
| Locus tag | NFH10_RS22570 | Protein ID | WP_000558165.1 |
| Coordinates | 4616962..4617273 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFH10_RS22575 | Protein ID | WP_001259009.1 |
| Coordinates | 4617270..4617716 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFH10_RS22540 (4612628) | 4612628..4613530 | + | 903 | WP_051129234.1 | formate dehydrogenase subunit beta | - |
| NFH10_RS22545 (4613527) | 4613527..4614162 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFH10_RS22550 (4614159) | 4614159..4615088 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NFH10_RS22555 (4615126) | 4615126..4615500 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| NFH10_RS22560 (4615500) | 4615500..4615742 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| NFH10_RS22565 (4615947) | 4615947..4616876 | + | 930 | WP_001162861.1 | alpha/beta hydrolase | - |
| NFH10_RS22570 (4616962) | 4616962..4617273 | + | 312 | WP_000558165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NFH10_RS22575 (4617270) | 4617270..4617716 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NFH10_RS22580 (4617731) | 4617731..4618672 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NFH10_RS22585 (4618717) | 4618717..4619154 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NFH10_RS22590 (4619151) | 4619151..4620023 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NFH10_RS22595 (4620017) | 4620017..4620616 | - | 600 | WP_023227076.1 | glucose-1-phosphatase | - |
| NFH10_RS22600 (4620807) | 4620807..4621610 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| NFH10_RS22605 (4621644) | 4621644..4622540 | - | 897 | WP_023227075.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12433.34 Da Isoelectric Point: 8.4020
>T248143 WP_000558165.1 NZ_CP098831:4616962-4617273 [Salmonella enterica subsp. enterica serovar Indiana]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT248143 WP_001259009.1 NZ_CP098831:4617270-4617716 [Salmonella enterica subsp. enterica serovar Indiana]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|