Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4798783..4799537 | Replicon | chromosome |
| Accession | NZ_CP098829 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS6 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4Y6MJG6 |
| Locus tag | NFG92_RS23480 | Protein ID | WP_000558165.1 |
| Coordinates | 4798783..4799094 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFG92_RS23485 | Protein ID | WP_001259009.1 |
| Coordinates | 4799091..4799537 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFG92_RS23450 (4794449) | 4794449..4795351 | + | 903 | WP_051129234.1 | formate dehydrogenase subunit beta | - |
| NFG92_RS23455 (4795348) | 4795348..4795983 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFG92_RS23460 (4795980) | 4795980..4796909 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NFG92_RS23465 (4796947) | 4796947..4797321 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| NFG92_RS23470 (4797321) | 4797321..4797563 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| NFG92_RS23475 (4797768) | 4797768..4798697 | + | 930 | WP_001162861.1 | alpha/beta hydrolase | - |
| NFG92_RS23480 (4798783) | 4798783..4799094 | + | 312 | WP_000558165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NFG92_RS23485 (4799091) | 4799091..4799537 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NFG92_RS23490 (4799552) | 4799552..4800493 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NFG92_RS23495 (4800538) | 4800538..4800975 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NFG92_RS23500 (4800972) | 4800972..4801844 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NFG92_RS23505 (4801838) | 4801838..4802437 | - | 600 | WP_023227076.1 | glucose-1-phosphatase | - |
| NFG92_RS23510 (4802628) | 4802628..4803431 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| NFG92_RS23515 (4803465) | 4803465..4804361 | - | 897 | WP_023227075.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12433.34 Da Isoelectric Point: 8.4020
>T248129 WP_000558165.1 NZ_CP098829:4798783-4799094 [Salmonella enterica subsp. enterica serovar Indiana]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT248129 WP_001259009.1 NZ_CP098829:4799091-4799537 [Salmonella enterica subsp. enterica serovar Indiana]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|