Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5594122..5594719 | Replicon | chromosome |
Accession | NZ_CP098805 | ||
Organism | Dyadobacter chenhuakuii strain CY22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFI80_RS23490 | Protein ID | WP_235164012.1 |
Coordinates | 5594122..5594400 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | NFI80_RS23495 | Protein ID | WP_235164013.1 |
Coordinates | 5594411..5594719 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFI80_RS23465 (NFI80_23465) | 5589968..5590381 | + | 414 | WP_235164008.1 | type II 3-dehydroquinate dehydratase | - |
NFI80_RS23470 (NFI80_23470) | 5590382..5592871 | - | 2490 | WP_235164009.1 | M14 family zinc carboxypeptidase | - |
NFI80_RS23480 (NFI80_23480) | 5593308..5593559 | - | 252 | WP_235164010.1 | hypothetical protein | - |
NFI80_RS23485 (NFI80_23485) | 5593671..5594015 | + | 345 | WP_235164011.1 | helix-turn-helix transcriptional regulator | - |
NFI80_RS23490 (NFI80_23490) | 5594122..5594400 | + | 279 | WP_235164012.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFI80_RS23495 (NFI80_23495) | 5594411..5594719 | + | 309 | WP_235164013.1 | HigA family addiction module antitoxin | Antitoxin |
NFI80_RS23500 (NFI80_23500) | 5595010..5595603 | - | 594 | WP_235164014.1 | hypothetical protein | - |
NFI80_RS23505 (NFI80_23505) | 5595631..5595828 | - | 198 | WP_235164015.1 | hypothetical protein | - |
NFI80_RS23510 (NFI80_23510) | 5595912..5597018 | - | 1107 | WP_235164016.1 | MBL fold metallo-hydrolase | - |
NFI80_RS23515 (NFI80_23515) | 5597150..5599024 | + | 1875 | WP_235164017.1 | CocE/NonD family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10886.47 Da Isoelectric Point: 6.4829
>T248105 WP_235164012.1 NZ_CP098805:5594122-5594400 [Dyadobacter chenhuakuii]
MIESIQHKGLRLLFEEDNSSKLPPHLVERIREILSLLDVAETIEQLNVSGYRLHKLTGEFKDFYSIRVSGNYRIIFRFVD
GKVFDVNYLDYH
MIESIQHKGLRLLFEEDNSSKLPPHLVERIREILSLLDVAETIEQLNVSGYRLHKLTGEFKDFYSIRVSGNYRIIFRFVD
GKVFDVNYLDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|