Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 86342..86927 | Replicon | plasmid p1VB280821 |
Accession | NZ_CP098796 | ||
Organism | Acinetobacter baumannii strain VB280821 |
Toxin (Protein)
Gene name | higB | Uniprot ID | N9CJF7 |
Locus tag | NE424_RS19770 | Protein ID | WP_000897307.1 |
Coordinates | 86607..86927 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NE424_RS19765 | Protein ID | WP_000369781.1 |
Coordinates | 86342..86614 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE424_RS19750 (NE424_19750) | 81856..83181 | - | 1326 | WP_252172182.1 | ISNCY family transposase | - |
NE424_RS19755 (NE424_19755) | 83434..84318 | - | 885 | WP_000155092.1 | Mph(E) family macrolide 2'-phosphotransferase | - |
NE424_RS19760 (NE424_19760) | 84374..85849 | - | 1476 | WP_000052512.1 | ABC-F type ribosomal protection protein Msr(E) | - |
NE424_RS19765 (NE424_19765) | 86342..86614 | - | 273 | WP_000369781.1 | NadS family protein | Antitoxin |
NE424_RS19770 (NE424_19770) | 86607..86927 | - | 321 | WP_000897307.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NE424_RS19775 (NE424_19775) | 87067..87486 | + | 420 | WP_001180106.1 | SMI1/KNR4 family protein | - |
NE424_RS19780 (NE424_19780) | 87586..88794 | - | 1209 | WP_042090285.1 | IS256 family transposase | - |
NE424_RS19785 (NE424_19785) | 88894..89175 | - | 282 | WP_000985609.1 | putative addiction module antidote protein | - |
NE424_RS19790 (NE424_19790) | 89176..89478 | - | 303 | WP_000286964.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NE424_RS19795 (NE424_19795) | 89771..90861 | + | 1091 | WP_252172194.1 | IS4-like element ISAba33 family transposase | - |
NE424_RS19800 (NE424_19800) | 90858..91346 | + | 489 | WP_252172183.1 | hypothetical protein | - |
NE424_RS19805 (NE424_19805) | 91615..91902 | + | 288 | WP_000438825.1 | BrnT family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 / blaNDM-1 | - | 1..141631 | 141631 | |
- | inside | IScluster/Tn | aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 | - | 72780..106272 | 33492 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12187.95 Da Isoelectric Point: 7.1639
>T248095 WP_000897307.1 NZ_CP098796:c86927-86607 [Acinetobacter baumannii]
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|