Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 86340..86925 Replicon plasmid p1VB280820
Accession NZ_CP098792
Organism Acinetobacter baumannii strain 280820

Toxin (Protein)


Gene name higB Uniprot ID N9CJF7
Locus tag NE421_RS20145 Protein ID WP_000897307.1
Coordinates 86605..86925 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NE421_RS20140 Protein ID WP_000369781.1
Coordinates 86340..86612 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE421_RS20125 (NE421_20125) 81854..83179 - 1326 WP_252172182.1 ISNCY family transposase -
NE421_RS20130 (NE421_20130) 83432..84316 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
NE421_RS20135 (NE421_20135) 84372..85847 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
NE421_RS20140 (NE421_20140) 86340..86612 - 273 WP_000369781.1 NadS family protein Antitoxin
NE421_RS20145 (NE421_20145) 86605..86925 - 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NE421_RS20150 (NE421_20150) 87065..87484 + 420 WP_001180106.1 SMI1/KNR4 family protein -
NE421_RS20155 (NE421_20155) 87584..88792 - 1209 WP_042090285.1 IS256 family transposase -
NE421_RS20160 (NE421_20160) 88892..89173 - 282 WP_000985609.1 putative addiction module antidote protein -
NE421_RS20165 (NE421_20165) 89174..89476 - 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
NE421_RS20170 (NE421_20170) 89769..90859 + 1091 WP_252172194.1 IS4-like element ISAba33 family transposase -
NE421_RS20175 (NE421_20175) 90856..91344 + 489 WP_252172183.1 hypothetical protein -
NE421_RS20180 (NE421_20180) 91433..91747 - 315 WP_004728120.1 BrnA antitoxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 / blaNDM-1 - 1..141629 141629
- inside IScluster/Tn aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 - 72778..106270 33492


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(41-102)

Antitoxin

Cro/C1-type helix-turn-helix domain

(37-85)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12187.95 Da        Isoelectric Point: 7.1639

>T248091 WP_000897307.1 NZ_CP098792:c86925-86605 [Acinetobacter baumannii]
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG

Download         Length: 321 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10149.61 Da        Isoelectric Point: 8.6582

>AT248091 WP_000369781.1 NZ_CP098792:c86612-86340 [Acinetobacter baumannii]
MDNNLFDDLVASIKEAGAIKRKEVKASRVTELELPDIKEVREKTGLSQNEFAARLHISPRTLQNWEQGRRYPTGPAATLI
RILDAHPSLI

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TMZ3

Antitoxin

Source ID Structure

References