Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2839461..2840121 | Replicon | chromosome |
| Accession | NZ_CP098778 | ||
| Organism | Enterobacter hormaechei strain YQ13422hy | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2J0Q4X0 |
| Locus tag | ND013_RS13705 | Protein ID | WP_017383312.1 |
| Coordinates | 2839768..2840121 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2J0Q4Z7 |
| Locus tag | ND013_RS13700 | Protein ID | WP_017383313.1 |
| Coordinates | 2839461..2839763 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND013_RS13685 | 2835631..2836956 | + | 1326 | WP_126499110.1 | SidA/IucD/PvdA family monooxygenase | - |
| ND013_RS13690 | 2836983..2839172 | + | 2190 | WP_126499109.1 | TonB-dependent siderophore receptor | - |
| ND013_RS13700 | 2839461..2839763 | - | 303 | WP_017383313.1 | XRE family transcriptional regulator | Antitoxin |
| ND013_RS13705 | 2839768..2840121 | - | 354 | WP_017383312.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ND013_RS13710 | 2840312..2841262 | - | 951 | WP_017383311.1 | HTH-type transcriptional regulator Cbl | - |
| ND013_RS13715 | 2841359..2842276 | - | 918 | WP_003859531.1 | nitrogen assimilation transcriptional regulator NAC | - |
| ND013_RS13725 | 2842808..2843740 | - | 933 | WP_126499108.1 | L,D-transpeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13537.37 Da Isoelectric Point: 9.9538
>T248084 WP_017383312.1 NZ_CP098778:c2840121-2839768 [Enterobacter hormaechei]
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0Q4X0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0Q4Z7 |