Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 1185280..1185829 | Replicon | chromosome |
| Accession | NZ_CP098778 | ||
| Organism | Enterobacter hormaechei strain YQ13422hy | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | ND013_RS05660 | Protein ID | WP_023296064.1 |
| Coordinates | 1185280..1185561 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0D7L8S0 |
| Locus tag | ND013_RS05665 | Protein ID | WP_015571209.1 |
| Coordinates | 1185542..1185829 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND013_RS05640 | 1180395..1181366 | + | 972 | WP_045344575.1 | LacI family DNA-binding transcriptional regulator | - |
| ND013_RS05645 | 1181367..1182611 | - | 1245 | WP_015571212.1 | mechanosensitive ion channel family protein | - |
| ND013_RS05650 | 1182679..1184115 | - | 1437 | WP_017382555.1 | MFS transporter | - |
| ND013_RS05655 | 1184223..1185092 | + | 870 | WP_045357441.1 | helix-turn-helix transcriptional regulator | - |
| ND013_RS05660 | 1185280..1185561 | + | 282 | WP_023296064.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ND013_RS05665 | 1185542..1185829 | + | 288 | WP_015571209.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| ND013_RS05670 | 1185866..1186519 | - | 654 | WP_003858884.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| ND013_RS05675 | 1186640..1187008 | - | 369 | WP_126499141.1 | MmcQ/YjbR family DNA-binding protein | - |
| ND013_RS05680 | 1186998..1187588 | - | 591 | WP_003858882.1 | TetR/AcrR family transcriptional regulator | - |
| ND013_RS05685 | 1187780..1188883 | + | 1104 | WP_126499142.1 | RomA family MBL fold metallo-hydrolase | - |
| ND013_RS05690 | 1188916..1189257 | + | 342 | WP_003858880.1 | RamA family antibiotic efflux transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10931.84 Da Isoelectric Point: 10.8507
>T248077 WP_023296064.1 NZ_CP098778:1185280-1185561 [Enterobacter hormaechei]
MPAGVQAKLIRQLDKLRNNPTVLREPDSKPLPNGLFEIRTVGLIHTRGIYVYQRERTIFLLRVFIKKTQKTPSAELRLAL
KRQQEMLDEQKDY
MPAGVQAKLIRQLDKLRNNPTVLREPDSKPLPNGLFEIRTVGLIHTRGIYVYQRERTIFLLRVFIKKTQKTPSAELRLAL
KRQQEMLDEQKDY
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|