Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2831192..2831839 | Replicon | chromosome |
Accession | NZ_CP098777 | ||
Organism | Cronobacter sakazakii strain JXES-28 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NES82_RS13870 | Protein ID | WP_161574444.1 |
Coordinates | 2831492..2831839 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | V5TYW5 |
Locus tag | NES82_RS13865 | Protein ID | WP_007776551.1 |
Coordinates | 2831192..2831491 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NES82_RS13835 (NES82_13840) | 2826602..2827168 | + | 567 | WP_054624204.1 | DedA family protein | - |
NES82_RS13840 (NES82_13845) | 2827165..2827938 | - | 774 | WP_054624203.1 | SDR family oxidoreductase | - |
NES82_RS13845 (NES82_13850) | 2828111..2828194 | + | 84 | WP_000691708.1 | small membrane protein YohP | - |
NES82_RS13850 (NES82_13855) | 2828231..2829190 | - | 960 | WP_161574443.1 | MBL fold metallo-hydrolase | - |
NES82_RS13855 (NES82_13860) | 2829263..2830186 | + | 924 | WP_054624201.1 | LysR family transcriptional regulator | - |
NES82_RS13860 (NES82_13865) | 2830189..2831121 | - | 933 | WP_032988286.1 | tRNA dihydrouridine(16) synthase DusC | - |
NES82_RS13865 (NES82_13870) | 2831192..2831491 | - | 300 | WP_007776551.1 | XRE family transcriptional regulator | Antitoxin |
NES82_RS13870 (NES82_13875) | 2831492..2831839 | - | 348 | WP_161574444.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NES82_RS13875 (NES82_13880) | 2832092..2832493 | + | 402 | WP_007869367.1 | CidA/LrgA family protein | - |
NES82_RS13880 (NES82_13885) | 2832490..2833185 | + | 696 | WP_063264311.1 | CidB/LrgB family autolysis modulator | - |
NES82_RS13885 (NES82_13890) | 2833315..2834199 | + | 885 | WP_161574445.1 | cytidine deaminase | - |
NES82_RS13890 (NES82_13895) | 2834324..2835037 | + | 714 | WP_007794951.1 | outer membrane permeability protein SanA | - |
NES82_RS13895 (NES82_13900) | 2835702..2836712 | - | 1011 | WP_004387466.1 | galactose/methyl galactoside ABC transporter permease MglC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13283.50 Da Isoelectric Point: 10.0481
>T248068 WP_161574444.1 NZ_CP098777:c2831839-2831492 [Cronobacter sakazakii]
MWTIYLTHEFECWLAGQPQPLQEDVLAALGLLKIKGPHLGRPYADTLKGSRHAGMKALRVQHAGRPIRAFYAFDPHRYAI
VLCAAEKKGDEKRFYRVILRVADKLFSHYLNHREV
MWTIYLTHEFECWLAGQPQPLQEDVLAALGLLKIKGPHLGRPYADTLKGSRHAGMKALRVQHAGRPIRAFYAFDPHRYAI
VLCAAEKKGDEKRFYRVILRVADKLFSHYLNHREV
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|